FNDC3B Antibody

Images

 
Western Blot: FNDC3B Antibody [NBP1-90495] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: FNDC3B Antibody [NBP1-90495] - Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: FNDC3B Antibody [NBP1-90495] - Staining of human cerebral cortex shows strong nuclear and moderate cytoplasmic positivity in neuronal cells.
Western Blot: FNDC3B Antibody [NBP1-90495] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FNDC3B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SIPPIHVPPGYISQVIEDSTGVRRVVVTPQSPECYPPSYPSAMSPTHHLPPYLTHHPHFIHNSHTAYYPPVTGPGDMPPQFFPQHHLPHTIYGEQEIIPFYGMSTYITREDQYSK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FNDC3B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FNDC3B Protein (NBP1-90495PEP)
Publications
Read Publication using NBP1-90495.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FNDC3B Antibody

  • FAD104
  • fibronectin type III domain containing 3B
  • FLJ23399
  • HCV NS5A-binding protein 37
  • MGC10002
  • NS5ABP37
  • PRO4979
  • UNQ2421/PRO4979/PRO34274
  • YVTM2421

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-69312
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3025
Species: Hu
Applications: WB, ICC
AF2250
Species: Hu
Applications: WB, IHC
NBP1-82267
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-13169
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-33041
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5890
Species: Mu
Applications: WB, Simple Western, IHC
DDX0390P-100
Species: Mu
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vivo
AF7109
Species: Mu
Applications: WB, IHC
NBP2-29940
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
AF4509
Species: Hu
Applications: WB, ICC
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-46424
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90495
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FNDC3B Antibody (NBP1-90495)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for FNDC3B Antibody (NBP1-90495) (0)

There are no reviews for FNDC3B Antibody (NBP1-90495). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FNDC3B Antibody (NBP1-90495) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FNDC3B Products

Bioinformatics Tool for FNDC3B Antibody (NBP1-90495)

Discover related pathways, diseases and genes to FNDC3B Antibody (NBP1-90495). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FNDC3B Antibody (NBP1-90495)

Discover more about diseases related to FNDC3B Antibody (NBP1-90495).
 

Pathways for FNDC3B Antibody (NBP1-90495)

View related products by pathway.

PTMs for FNDC3B Antibody (NBP1-90495)

Learn more about PTMs related to FNDC3B Antibody (NBP1-90495).

Blogs on FNDC3B

There are no specific blogs for FNDC3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FNDC3B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FNDC3B