FNDC3B Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: FNDC3B Antibody [NBP1-90495] - Staining of human cell line U-251 MG shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.

Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Staining of human lymphoid tissues shows weak cytoplasmic positivity in non-germinal center cells germinal center cells.

Staining of human skin shows moderate cytoplasmic membranous positivity in squamous epithelial cells.

Analysis in human cell line A-549.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FNDC3B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SIPPIHVPPGYISQVIEDSTGVRRVVVTPQSPECYPPSYPSAMSPTHHLPPYLTHHPHFIHNSHTAYYPPVTGPGDMPPQFFPQHHLPHTIYGEQEIIPFYGMSTYITREDQYSK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FNDC3B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FNDC3B Protein (NBP1-90495PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FNDC3B Antibody - BSA Free

• FAD104
• fibronectin type III domain containing 3B
• FLJ23399
• HCV NS5A-binding protein 37
• MGC10002
• NS5ABP37
• PRO4979
• UNQ2421/PRO4979/PRO34274
• YVTM2421

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FNDC3B Antibody (NBP1-90495)(3)

Publications using NBP1-90495

• Qiuyu Martin Zhu, Yu-Han H Hsu, Frederik H Lassen, Bryan T MacDonald, Stephanie Stead, Edyta Malolepsza, April Kim, Taibo Li, Taiji Mizoguchi, Monica Schenone, Gaelen Guzman, Benjamin Tanenbaum, Nadine Fornelos, Steven A Carr, Rajat M Gupta, Patrick T Ellinor, Kasper Lage Protein interaction networks in the vasculature prioritize genes and pathways underlying coronary artery disease. Communications biology 2024-01-15 [PMID: 38216744]
• Fucci C, Resnati M, Riva E et al. The Interaction of the Tumor Suppressor FAM46C with p62 and FNDC3 Proteins Integrates Protein and Secretory Homeostasis Cell Rep 2020-09-22 [PMID: 32966780] (ICC/IF, Human)
• Feng S, Han M, Zhou L et al. NS5ABP37 inhibits liver cancer by impeding lipogenesis and cholesterogenesis. Cancer Sci 2017-01-01 [PMID: 27862769] (Human)

Bioinformatics

• Gene Symbol: FNDC3B