UBXN10 Antibody

Images

 
Immunohistochemistry-Paraffin: UBXN10 Antibody [NBP1-83561] - Staining of human fallopian tube shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UBXN10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RFVRHFRPTDDLQTIVAVAEQKNKTSYRHCSIETMEVPRRRFSDLTKSLQECRIPHKSVLGISLEDGEGW
Specificity
Specificity of human UBXN10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBXN10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
WB, ICC/IF reported in scientific literature (PMID: 26389662). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
UBXN10 Protein (NBP1-83561PEP)
Publications
Read Publication using
NBP1-83561 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (80%). Human reactivity reported in scientific literature (PMID: 26389662).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UBXN10 Antibody

  • FLJ25429
  • UBX domain containing 3
  • UBX domain protein 10
  • UBX domain-containing protein 10
  • UBX domain-containing protein 3
  • UBXD3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00002166-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA, S-ELISA
DDX0390P-100
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, B/N, IHC-FrFl
NBP1-88954
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4509
Species: Hu
Applications: WB, ICC
AF3166
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-32682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46424
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14408
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19727
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
AF2864
Species: Hu
Applications: WB, ICC
MAB6435
Species: Hu, Mu
Applications: WB
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP3-04703
Species: Hu, Mu
Applications: WB, ICC/IF
H00284111-M06
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-03828
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP3-05186
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-90495
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00079187-B01P
Species: Hu
Applications: WB
NBP1-83561
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for UBXN10 Antibody (NBP1-83561)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for UBXN10 Antibody (NBP1-83561) (0)

There are no reviews for UBXN10 Antibody (NBP1-83561). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UBXN10 Antibody (NBP1-83561) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional UBXN10 Products

Bioinformatics Tool for UBXN10 Antibody (NBP1-83561)

Discover related pathways, diseases and genes to UBXN10 Antibody (NBP1-83561). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on UBXN10

There are no specific blogs for UBXN10, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBXN10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBXN10