PRAF1 Antibody

Images

 
Western Blot: PRAF1 Antibody [NBP1-89867] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: PRAF1 Antibody [NBP1-89867] - Staining of human cell line U-251MG shows positivity in nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: PRAF1 Antibody [NBP1-89867] - Staining of human rectum shows nucleolar and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRAF1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLQFPLGQDPSFLAIPILALPPSDSLVPPYIVWYIVWPSALISFLGCTLTVQFSNGKLQSPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLR1E
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PRAF1 Protein (NBP1-89867PEP)
Publications
Read Publication using NBP1-89867.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23470167)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRAF1 Antibody

  • DNA-directed RNA polymerase I subunit E
  • DNA-directed RNA polymerase I subunit RPA49
  • FLJ13390
  • FLJ13970
  • FLJ43482
  • PAF53RNA polymerase I-associated factor 1
  • polymerase (RNA) I associated factor 1
  • polymerase (RNA) I polypeptide E, 53kDa
  • PRAF1
  • RNA polymerase I associated factor 53
  • RNA polymerase I subunit A49
  • RNA polymerase I-associated factor 53
  • RP11-405L18.3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82545
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1105
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00010849-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-87886
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-80883
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-269
Species: Hu, Mu, Rt, Ce, Ch, Dr, Pl, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP2-38206
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-47609
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-23017
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-12779
Species: Hu
Applications: WB, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for PRAF1 Antibody (NBP1-89867)(1)


Reviews for PRAF1 Antibody (NBP1-89867) (0)

There are no reviews for PRAF1 Antibody (NBP1-89867). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PRAF1 Antibody (NBP1-89867) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRAF1 Products

Bioinformatics Tool for PRAF1 Antibody (NBP1-89867)

Discover related pathways, diseases and genes to PRAF1 Antibody (NBP1-89867). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRAF1 Antibody (NBP1-89867)

Discover more about diseases related to PRAF1 Antibody (NBP1-89867).
 

Pathways for PRAF1 Antibody (NBP1-89867)

View related products by pathway.

PTMs for PRAF1 Antibody (NBP1-89867)

Learn more about PTMs related to PRAF1 Antibody (NBP1-89867).

Blogs on PRAF1

There are no specific blogs for PRAF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRAF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR1E