TAF148 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TAF148 Antibody [NBP2-47609] - Staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry: TAF148 Antibody [NBP2-47609] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAF148 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HQWQQAAEYMYSYFQTLEDSDSYKRQAAPEIIWKLGSEILFYHPKSNMESFNTFANRMKNIGVMNYLKISLQHALYLLHHGMLKDAKRNLSE
Specificity
Specificity of human TAF148 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAF1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TAF148 Protein (NBP2-47609PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TAF148 Antibody

  • RAFI48
  • SL1MGC:17061
  • TAFI48TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kD
  • TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa
  • TATA box-binding protein-associated factor 1A
  • TATA box-binding protein-associated factor RNA polymerase I subunit A
  • TBP-associated factor 1A
  • Transcription factor SL1,48kD subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, CHIP-SEQ, KD
NBP1-82545
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00009014-B01P
Species: Hu
Applications: WB, ICC/IF
AF1334
Species: Hu
Applications: WB, IHC
NBP2-38188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46290
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71822
Species: Hu
Applications: WB, IP
NB500-186
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF5866
Species: Hu
Applications: WB, IHC
NBP2-19676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88376
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-61646
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-47609
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for TAF148 Antibody (NBP2-47609) (0)

There are no publications for TAF148 Antibody (NBP2-47609).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF148 Antibody (NBP2-47609) (0)

There are no reviews for TAF148 Antibody (NBP2-47609). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TAF148 Antibody (NBP2-47609) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TAF148 Products

Bioinformatics Tool for TAF148 Antibody (NBP2-47609)

Discover related pathways, diseases and genes to TAF148 Antibody (NBP2-47609). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAF148 Antibody (NBP2-47609)

Discover more about diseases related to TAF148 Antibody (NBP2-47609).
 

Pathways for TAF148 Antibody (NBP2-47609)

View related products by pathway.

PTMs for TAF148 Antibody (NBP2-47609)

Learn more about PTMs related to TAF148 Antibody (NBP2-47609).

Blogs on TAF148

There are no specific blogs for TAF148, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAF148 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF1A