UBPY/USP8 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: UBPY/USP8 Antibody [NBP2-55627] - Staining of human cell line U-251 MG shows localization to cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: UBPY/USP8 Antibody [NBP2-55627] - Staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UBPY/USP8 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTD
Specificity
Specificity of human UBPY/USP8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USP8
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UBPY/USP8 Recombinant Protein Antigen (NBP2-55627PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for UBPY/USP8 Antibody

  • Deubiquitinating enzyme 8
  • EC 3.1.2.15
  • EC 3.4.19.12
  • HumORF8
  • KIAA0055hUBPy
  • MGC129718
  • ubiquitin carboxyl-terminal hydrolase 8
  • Ubiquitin isopeptidase Y
  • ubiquitin specific peptidase 8
  • ubiquitin specific protease 8
  • ubiquitin thioesterase 8
  • Ubiquitin thiolesterase 8
  • Ubiquitin-specific-processing protease 8
  • UBPY
  • UBPYFLJ34456
  • USP8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86037
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5650
Species: Hu
Applications: WB, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-83289
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87087
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56533
Species: Hu
Applications: WB
NBP1-83202
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6567
Species: Hu, Mu
Applications: WB, IHC
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31363
Species: Hu
Applications: WB, ICC/IF
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
H00010049-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB110-40730
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-54618
Species: Hu
Applications: WB, IHC
NBP1-89180
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for UBPY/USP8 Antibody (NBP2-55627) (0)

There are no publications for UBPY/USP8 Antibody (NBP2-55627).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBPY/USP8 Antibody (NBP2-55627) (0)

There are no reviews for UBPY/USP8 Antibody (NBP2-55627). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for UBPY/USP8 Antibody (NBP2-55627) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for UBPY/USP8 Antibody (NBP2-55627)

Discover related pathways, diseases and genes to UBPY/USP8 Antibody (NBP2-55627). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBPY/USP8 Antibody (NBP2-55627)

Discover more about diseases related to UBPY/USP8 Antibody (NBP2-55627).
 

Pathways for UBPY/USP8 Antibody (NBP2-55627)

View related products by pathway.

PTMs for UBPY/USP8 Antibody (NBP2-55627)

Learn more about PTMs related to UBPY/USP8 Antibody (NBP2-55627).

Blogs on UBPY/USP8

There are no specific blogs for UBPY/USP8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBPY/USP8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP8