UBL3 Antibody

Images

 
Western Blot: UBL3 Antibody [NBP1-74174] - Rat Kidney Lysate 1ug/ml Gel Concentration 10-20%

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UBL3 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Ubl3. Immunizing peptide sequence FLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Ubl3 and was validated on Western blot.
Theoretical MW
14 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UBL3 Antibody

  • DKFZP434K151
  • FLJ32018
  • HCG-1
  • hsMUB
  • Membrane-anchored ubiquitin-fold protein
  • MUB
  • PNSC1
  • Protein HCG-1
  • ubiquitin-like 3
  • ubiquitin-like protein 3

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-36751
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-03747
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24787
Species: Hu, Mu, Ca
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, Flow-CS, Flow-IC
MAB4066
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP2-27562
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
E2-616
Species: Hu
NBP2-46270
Species: Hu
Applications: WB, IHC
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-84721
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
PPS010
Species: Hu, Mu, Rt, Bv, Ch, Xp, Ze
Applications: WB
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-48748
Species: Hu
Applications: WB, IHC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-22568
Species: Hu
Applications: IHC-P
NBP1-84996
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-74174
Species: Rt
Applications: WB

Publications for UBL3 Antibody (NBP1-74174) (0)

There are no publications for UBL3 Antibody (NBP1-74174).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBL3 Antibody (NBP1-74174) (0)

There are no reviews for UBL3 Antibody (NBP1-74174). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UBL3 Antibody (NBP1-74174) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UBL3 Products

Bioinformatics Tool for UBL3 Antibody (NBP1-74174)

Discover related pathways, diseases and genes to UBL3 Antibody (NBP1-74174). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBL3 Antibody (NBP1-74174)

Discover more about diseases related to UBL3 Antibody (NBP1-74174).

Blogs on UBL3

There are no specific blogs for UBL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBL3
Uniprot