TUFM Antibody (CL2242)

Images

 
Genetic Strategies: Western Blot: TUFM Antibody (CL2242) [NBP2-36751] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-TUFM antibody. Remaining ...read more
Immunocytochemistry/ Immunofluorescence: TUFM Antibody (CL2242) [NBP2-36751] - Staining in MCF7 cell line with Anti-TUFM monoclonal antibody, showing distinct mitochondrial staining in green. Microtubule- and nuclear ...read more
Immunohistochemistry-Paraffin: TUFM Antibody (CL2242) [NBP2-36751] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts and in Leydig cells.
Western Blot: TUFM Antibody (CL2242) [NBP2-36751] - Lane 1: Marker [kDa]. Lane 2: Human cell line U-251 MG
Western Blot: TUFM Antibody (CL2242) [NBP2-36751] - Lane 1: Marker [kDa], Lane 2: Human cell line HeLa cytoplasmic fraction, Lane 3: Human cell line HeLa membrane fraction, Lane 4: Human cell line HeLa nuclear fraction, ...read more
Immunocytochemistry/ Immunofluorescence: TUFM Antibody (CL2242) [NBP2-36751] - Staining in HeLa cell line showing distinct mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red ...read more
Immunocytochemistry/ Immunofluorescence: TUFM Antibody (CL2242) [NBP2-36751] - Staining in U2OS cell line with Anti-TUFM monoclonal antibody, showing distinct mitochondrial staining in green. Microtubule-staining and ...read more
Immunocytochemistry/ Immunofluorescence: TUFM Antibody (CL2242) [NBP2-36751] - Staining in U251 cell line showing distinct mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red ...read more
Immunocytochemistry/ Immunofluorescence: TUFM Antibody (CL2242) [NBP2-36751] - Staining in A431 cell line with Anti-TUFM monoclonal antibody, showing distinct mitochondrial staining in green. Microtubule- and nuclear ...read more
Immunohistochemistry-Paraffin: TUFM Antibody (CL2242) [NBP2-36751] - Staining of human fallopian tube shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TUFM Antibody (CL2242) [NBP2-36751] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TUFM Antibody (CL2242) [NBP2-36751] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules and moderate staining in glomerular cells.

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IP, KD
Clone
CL2242
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

TUFM Antibody (CL2242) Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AVDTYIPVPARDLEKPFLLPVEAVYSVPGRGTVVTGTLERGILKKGDECELLGHSKNIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSI
Epitope
RDLEKPFLLPVEAVY
Specificity
Specificity of human TUFM antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%). Backed by our 100% Guarantee.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
TUFM
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunocytochemistry/Immunofluorescence 2-10 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Immunoprecipitation
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Immunoprecipitation reported in scientific literature (PMID:31801089).
Control Peptide
TUFM Recombinant Protein Antigen (NBP2-36751PEP)
Publications
Read Publication using
NBP2-36751 in the following applications:

  • IP
    1 publication
  • KD
    1 publication
  • WB
    1 publication

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions. Rat reactivity reported in scientific literature (PMID:31801089).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for TUFM Antibody (CL2242)

  • EFTu
  • EF-Tu
  • EFTUCOXPD4
  • EF-TuMT
  • elongation factor Tu, mitochondrial
  • P43
  • Tu translation elongation factor, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75478
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-76914
Species: Hu, Mu, Rt
Applications: DB, Flow, ICC/IF, IHC, IHC-P
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-94504
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP2-38780
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-82857
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009669-B01P
Species: Hu
Applications: WB, ICC/IF
H00026156-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-2269
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP2-36751
Species: Hu, Rt, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD

Publications for TUFM Antibody (NBP2-36751)(1)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 3 applications: IP, KD, WB.


Filter By Application
IP
(1)
KD
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Rat
(1)
All Species

Reviews for TUFM Antibody (NBP2-36751) (0)

There are no reviews for TUFM Antibody (NBP2-36751). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TUFM Antibody (NBP2-36751) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TUFM Products

Bioinformatics Tool for TUFM Antibody (NBP2-36751)

Discover related pathways, diseases and genes to TUFM Antibody (NBP2-36751). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TUFM Antibody (NBP2-36751)

Discover more about diseases related to TUFM Antibody (NBP2-36751).
 

Pathways for TUFM Antibody (NBP2-36751)

View related products by pathway.

PTMs for TUFM Antibody (NBP2-36751)

Learn more about PTMs related to TUFM Antibody (NBP2-36751).

Blogs on TUFM

There are no specific blogs for TUFM, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TUFM Antibody (CL2242) and receive a gift card or discount.

Bioinformatics

Gene Symbol TUFM
Uniprot