UBIAD1 Antibody - BSA Free

Western Blot: UBIAD1 Antibody [NBP2-55187] - Analysis in human fallopian tube tissue.

Immunocytochemistry/Immunofluorescence: UBIAD1 Antibody [NBP2-55187] - Staining of human cell line Hep G2 shows localization to vesicles. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UBIAD1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MAASQVLGEKINILSGETVKAGDRDPLGNDCPEQDRLPQRSWRQKCASYVLALRPWSFSASLTPVALGSALAYRSHGVLDPR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UBIAD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  UBIAD1 Recombinant Protein Antigen (NBP2-55187PEP)

Reactivity Notes

Mouse 82%, Rat 80%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for UBIAD1 Antibody - BSA Free

• EC 2.5.1.-
• RP4-796F18.1
• SCCD
• Schnyder crystalline corneal dystrophy
• TERE1transitional epithelia response protein
• Transitional epithelial response protein 1
• UbiA prenyltransferase domain containing 1
• ubiA prenyltransferase domain-containing protein 1

Background

UBIAD1 is a novel gene designated TERE1 that has a significant effect on the growth regulation in bladder cancer. The TERE1 gene maps to a chromosome locus that has been identified, in loss of heterozygosity studies, as a site of a putative tumor suppressor gene or genes for multiple tumor types including prostate carcinoma. Data suggest that TERE1 may be significant in prostate cancer growth regulation, and the down regulation or absence of TERE1 may be an important component of the phenotype of advanced disease. Data also suggest a potential role for this gene product in the progression of bladder cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UBIAD1