Sodium Calcium Exchanger 1/NCX1 Antibody - Azide and BSA Free

Images

 
Western Blot: Sodium Calcium Exchanger 1/NCX1 Antibody [NBP2-94316] - Analysis of extracts of various cell lines, using Sodium Calcium Exchanger 1/NCX1 antibody (NBP2-94316) at 1:5000 dilution. Secondary antibody: HRP ...read more
Immunohistochemistry-Paraffin: Sodium Calcium Exchanger 1/NCX1 Antibody [NBP2-94316] - Rat stomach using Sodium Calcium Exchanger 1/NCX1 Rabbit pAb (NBP2-94316) at dilution of 1:100 (40x lens). Perform high pressure ...read more
Western Blot: Sodium Calcium Exchanger 1/NCX1 Antibody [NBP2-94316] - Analysis of extracts of Mouse brain , using Sodium Calcium Exchanger 1/NCX1 antibody (NBP2-94316) at 1:5000 dilution. Secondary antibody: HRP Goat ...read more
Immunohistochemistry-Paraffin: Sodium Calcium Exchanger 1/NCX1 Antibody [NBP2-94316] - Human colon carcinoma using Sodium Calcium Exchanger 1/NCX1 Rabbit pAb (NBP2-94316) at dilution of 1:100 (40x lens). Perform high ...read more
Immunohistochemistry-Paraffin: Sodium Calcium Exchanger 1/NCX1 Antibody [NBP2-94316] - Mouse spleen using Sodium Calcium Exchanger 1/NCX1 Rabbit pAb (NBP2-94316) at dilution of 1:100 (40x lens). Perform high pressure ...read more

Order Details


    • Catalog Number
      NBP2-94316
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Sodium Calcium Exchanger 1/NCX1 Antibody - Azide and BSA Free Summary

Description
Novus Biologicals Rabbit Sodium Calcium Exchanger 1/NCX1 Antibody - Azide and BSA Free (NBP2-94316) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 600-700 of human Sodium Calcium Exchanger 1/NCX1 (NP_066920.1). DEIVKTISVKVIDDEEYEKNKTFFLEIGEPRLVEMSEKKALLLNELGGFTITGKYLFGQPVFRKVHAREHPILSTVITIADEYDDKQPLTSKEEEERRIAE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC8A1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA Recommended starting concentration is 1 μg/mL.
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:2000 - 1:6000
Theoretical MW
109 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for Sodium Calcium Exchanger 1/NCX1 Antibody - Azide and BSA Free

  • FLJ37694
  • FLJ43417
  • Na(+)/Ca(2+)-exchange protein 1
  • NCX1
  • Slc8a1
  • Sodium Calcium Exchanger 1
  • sodium/calcium exchanger 1
  • solute carrier family 8 (sodium/calcium exchanger), member 1

Background

NCX1 (Na(+)/Ca(2+) exchanger (NCX-1)) expression and protein levels vary during heart development and in response to changes in thyroid hormone levels (1). The expression of the NCX1 gene is two-fold higher in the hearts of fetal versus adult mice. In addition, NCX1 mRNA and protein levels were upregulated in hypothyroidic hearts. In hyperthyroidic hearts this response was reversed, however.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-82023
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB120-2869
Species: Bv, Ca, Gp, Hu, I, Ma, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-48980
Species: Hu
Applications: IHC,  IHC-P
MAB5745
Species: Hu
Applications: IHC, WB
NBP1-86125
Species: Hu
Applications: IHC,  IHC-P
NBP2-19807
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-93520
Species: Hu
Applications: PEP-ELISA, WB
NB300-581
Species: Am, Ca, Gp, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP3-47156
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
NBP2-30392
Species: Hu
Applications: IHC,  IHC-P
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-92397
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB120-3529
Species: Hu, Po, Rt
Applications: ELISA, IHC, IHC-Fr,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP3-33063
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB300-578
Species: Am, Ca, Ch, Fe, Ha, Hu, Mu, Po, Pm, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for Sodium Calcium Exchanger 1/NCX1 Antibody (NBP2-94316) (0)

There are no publications for Sodium Calcium Exchanger 1/NCX1 Antibody (NBP2-94316).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sodium Calcium Exchanger 1/NCX1 Antibody (NBP2-94316) (0)

There are no reviews for Sodium Calcium Exchanger 1/NCX1 Antibody (NBP2-94316). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sodium Calcium Exchanger 1/NCX1 Antibody (NBP2-94316) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Sodium Calcium Exchanger 1/NCX1 Products

Research Areas for Sodium Calcium Exchanger 1/NCX1 Antibody (NBP2-94316)

Find related products by research area.

Blogs on Sodium Calcium Exchanger 1/NCX1

There are no specific blogs for Sodium Calcium Exchanger 1/NCX1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sodium Calcium Exchanger 1/NCX1 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC8A1