UBIAD1 Antibody

Images

 
Western Blot: UBIAD1 Antibody [NBP2-55187] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunocytochemistry/ Immunofluorescence: UBIAD1 Antibody [NBP2-55187] - Staining of human cell line Hep G2 shows localization to vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UBIAD1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MAASQVLGEKINILSGETVKAGDRDPLGNDCPEQDRLPQRSWRQKCASYVLALRPWSFSASLTPVALGSALAYRSHGVLDPR
Specificity
Specificity of human UBIAD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBIAD1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UBIAD1 Recombinant Protein Antigen (NBP2-55187PEP)

Reactivity Notes

Mouse 82%, Rat 80%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for UBIAD1 Antibody

  • EC 2.5.1.-
  • RP4-796F18.1
  • SCCD
  • Schnyder crystalline corneal dystrophy
  • TERE1transitional epithelia response protein
  • Transitional epithelial response protein 1
  • UbiA prenyltransferase domain containing 1
  • ubiA prenyltransferase domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-26393
Species: Hu
Applications: WB, ICC/IF
NBP2-16463
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-83368
Species: Hu
Applications: WB, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-83708
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-93520
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP1-74138
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-56483
Species: Hu
Applications: ICC/IF
NBP2-15394
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for UBIAD1 Antibody (NBP2-55187) (0)

There are no publications for UBIAD1 Antibody (NBP2-55187).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBIAD1 Antibody (NBP2-55187) (0)

There are no reviews for UBIAD1 Antibody (NBP2-55187). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UBIAD1 Antibody (NBP2-55187) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for UBIAD1 Antibody (NBP2-55187)

Discover related pathways, diseases and genes to UBIAD1 Antibody (NBP2-55187). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBIAD1 Antibody (NBP2-55187)

Discover more about diseases related to UBIAD1 Antibody (NBP2-55187).
 

Pathways for UBIAD1 Antibody (NBP2-55187)

View related products by pathway.

PTMs for UBIAD1 Antibody (NBP2-55187)

Learn more about PTMs related to UBIAD1 Antibody (NBP2-55187).
 

Research Areas for UBIAD1 Antibody (NBP2-55187)

Find related products by research area.

Blogs on UBIAD1

There are no specific blogs for UBIAD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBIAD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBIAD1