UBE3B Antibody - BSA Free

Western Blot: UBE3B Antibody [NBP1-54950] - 293T cells lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

UBE3B Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to UBE3B(ubiquitin protein ligase E3B) The peptide sequence was selected from the middle region of UBE3B. Peptide sequence VDEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDERLYPSPTSYIHE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UBE3B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 123 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for UBE3B Antibody - BSA Free

• DKFZp586K2123
• DKFZp686A1051
• EC 6.3.2
• EC 6.3.2.-
• FLJ45294
• MGC131858
• MGC78388
• ubiquitin protein ligase E3B
• ubiquitin-protein ligase E3B

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE3B is a member of the E3 ubiquitin-conjugating enzyme family. UBE3B may interact with other proteins and play a role in stress response.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E3 ubiquitin-conjugating enzyme family. The encoded protein may interact with other proteins and play a role in stress response. Alternatively spliced transcript variants encoding the same protein isoform have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for UBE3B Antibody (NBP1-54950)(2)

Publications using NBP1-54950

• Wang, S;Li, H;Liu, X;Yin, T;Li, T;Zheng, M;Liu, M;Meng, X;Zhou, J;Wang, Y;Chen, Y; VHL suppresses UBE3B-mediated breast tumor growth and metastasis Cell death & disease 2024-06-24 [PMID: 38914543]
• Wang Y, Liu X, Wang M et al. UBE3B promotes breast cancer progression by antagonizing HIF-2? degradation Oncogene 2023-10-02 [PMID: 37783786]

Bioinformatics

• Gene Symbol: UBE3B
• Uniprot:
  • Q7Z3V4(Human)