We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

UBE3B Antibody - BSA Free

Images

 
Western Blot: UBE3B Antibody [NBP1-54950] - 293T cells lysate, concentration 0.2-1 ug/ml.
VHL inhibits the UBE3B-mediated tumorigenic potential of breast cancer cells.A Protein levels of Flag-VHL and Myc-UBE3B in the stable MDA-MB-231 cell line expressing Flag-VHL or Myc-UBE3B. B The cell proliferation rate ...read more
VHL decreases UBE3B protein levels in breast cancer cells.A Protein levels of endogenous UBE3B were assessed in MDA-MB-231 and T47D cells stably expressing either wild-type (WT) or catalytically inactive (Y112H) ...read more
VHL decreases UBE3B protein levels in breast cancer cells.A Protein levels of endogenous UBE3B were assessed in MDA-MB-231 and T47D cells stably expressing either wild-type (WT) or catalytically inactive (Y112H) ...read more
VHL decreases UBE3B protein levels in breast cancer cells.A Protein levels of endogenous UBE3B were assessed in MDA-MB-231 and T47D cells stably expressing either wild-type (WT) or catalytically inactive (Y112H) ...read more
VHL decreases UBE3B protein levels in breast cancer cells.A Protein levels of endogenous UBE3B were assessed in MDA-MB-231 and T47D cells stably expressing either wild-type (WT) or catalytically inactive (Y112H) ...read more
VHL decreases UBE3B protein levels in breast cancer cells.A Protein levels of endogenous UBE3B were assessed in MDA-MB-231 and T47D cells stably expressing either wild-type (WT) or catalytically inactive (Y112H) ...read more
VHL decreases UBE3B protein levels in breast cancer cells.A Protein levels of endogenous UBE3B were assessed in MDA-MB-231 and T47D cells stably expressing either wild-type (WT) or catalytically inactive (Y112H) ...read more
VHL-mediated UBE3B ubiquitination is essential for VHL in suppressing breast tumor growth and metastasis.A–C Tumor images (A), tumor growth curves (B), and tumor weight (C) of mice bearing DKO+2P2A + Myc-UBE3B-WT, ...read more
VHL-mediated UBE3B ubiquitination is essential for VHL in suppressing breast tumor growth and metastasis.A–C Tumor images (A), tumor growth curves (B), and tumor weight (C) of mice bearing DKO+2P2A + Myc-UBE3B-WT, ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

UBE3B Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to UBE3B(ubiquitin protein ligase E3B) The peptide sequence was selected from the middle region of UBE3B. Peptide sequence VDEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDERLYPSPTSYIHE. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBE3B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
123 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using NBP1-54950.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for UBE3B Antibody - BSA Free

  • DKFZp586K2123
  • DKFZp686A1051
  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ45294
  • MGC131858
  • MGC78388
  • ubiquitin protein ligase E3B
  • ubiquitin-protein ligase E3B

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE3B is a member of the E3 ubiquitin-conjugating enzyme family. UBE3B may interact with other proteins and play a role in stress response.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E3 ubiquitin-conjugating enzyme family. The encoded protein may interact with other proteins and play a role in stress response. Alternatively spliced transcript variants encoding the same protein isoform have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1031
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00004598-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
H00004595-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP1-25973
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-Fr,  IHC-P, WB
NB300-581
Species: Am, Ca, Gp, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP1-71701
Species: Hu, Mu, Rt
Applications: WB
NB110-41539
Species: Hu, Mu
Applications: ICC/IF, WB
NB100-96916
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
MAB2476
Species: Hu
Applications: IHC, WB
NBP1-90063
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF7895
Species: Hu
Applications: IHC, WB
NBP1-90274
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-92180
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
AF2009
Species: Hu
Applications: ICC, IHC
NBP1-88584
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-12316
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, IP, WB

Publications for UBE3B Antibody (NBP1-54950)(2)

Reviews for UBE3B Antibody (NBP1-54950) (0)

There are no reviews for UBE3B Antibody (NBP1-54950). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UBE3B Antibody (NBP1-54950) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBE3B Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE3B
Uniprot