UBE2S Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit UBE2S Antibody - BSA Free (NBP2-38822) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPN |
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
UBE2S |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for UBE2S Antibody - BSA Free
Background
UBE2S, also known as ubiquitin-conjugating enzyme E2S, is a member of the ubiquitin-conjugating enzyme family. This protein is able to form a thiol ester linkage with ubiquitin in an ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins. It catalyzes the covalent attachment of ubiquitin to other proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: IHC, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: IP, WB
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: EnzAct
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Publications for UBE2S Antibody (NBP2-38822) (0)
There are no publications for UBE2S Antibody (NBP2-38822).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for UBE2S Antibody (NBP2-38822) (0)
There are no reviews for UBE2S Antibody (NBP2-38822).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for UBE2S Antibody (NBP2-38822) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional UBE2S Products
Research Areas for UBE2S Antibody (NBP2-38822)
Find related products by research area.
|
Blogs on UBE2S