UbcH10/UBE2C Antibody (9D3)

Images

 
Western Blot: UbcH10/UBE2C Antibody (9D3) [H00011065-M01] - UBE2C monoclonal antibody (M01), clone 9D3 Analysis of UBE2C expression in HeLa.
Immunocytochemistry/ Immunofluorescence: UbcH10/UBE2C Antibody (9D3) [H00011065-M01] - Analysis of monoclonal antibody to UBE2C on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: UbcH10/UBE2C Antibody (9D3) [H00011065-M01] - Analysis of monoclonal antibody to UBE2C on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml.
Western Blot: UbcH10/UBE2C Antibody (9D3) [H00011065-M01] - Analysis of UBE2C expression in transfected 293T cell line by UBE2C monoclonal antibody (M01), clone 9D3.Lane 1: UBE2C transfected lysate(19.7 KDa).Lane 2: ...read more
ELISA: UbcH10/UBE2C Antibody (9D3) [H00011065-M01] - Detection limit for recombinant GST tagged UBE2C is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
9D3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UbcH10/UBE2C Antibody (9D3) Summary

Immunogen
UBE2C (NP_008950, 70 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
Localization
Nuclear
Specificity
UBE2C - ubiquitin-conjugating enzyme E2C
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UBE2C
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publications using
H00011065-M01 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UbcH10/UBE2C Antibody (9D3)

  • cyclin-selective ubiquitin carrier protein
  • dJ447F3.2
  • EC 6.3.2.19
  • UbcH10
  • UBCH10mitotic-specific ubiquitin-conjugating enzyme
  • UBE2C
  • Ubiquitin carrier protein C
  • ubiquitin carrier protein E2-C
  • ubiquitin-conjugating enzyme E2 C
  • ubiquitin-conjugating enzyme E2C
  • Ubiquitin-protein ligase C

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for the destruction of mitotic cyclins and for cell cycle progression. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66987
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF6000
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
E2-622
Species: Hu
Applications: EnzAct
NBP1-98549
Species: Hu
Applications: WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-59828
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
E2-616
Species: Hu
Applications: EnzAct
NBP2-75659
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
E2-690
Species: Hu
Applications: EnzAct
NB100-353
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
E2-627
Species: Hu
Applications: EnzAct
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB

Publications for UbcH10/UBE2C Antibody (H00011065-M01)(11)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publications 1 - 10 of 11. Show All 11 Publications.
Publications using H00011065-M01 Applications Species
Lin SL, Yeh JL, Tsai PC et al. Inhibition of Neointima Hyperplasia, Inflammation, and Reactive Oxygen Species in Balloon-Injured Arteries by HVJ Envelope Vector-Mediated Delivery of Superoxide Dismutase Gene. Transl Stroke Res Sep 6 2018 [PMID: 30191468]
Mo CH, Gao L, Zhu XF et al. The clinicopathological significance of UBE2C in breast cancer: a study based on immunohistochemistry, microarray and RNA-sequencing data. Cancer Cell Int Sep 25 2017 [PMID: 29021715]
Guo L, Ding Z, Huang N et al. Forkhead Box M1 positively regulates UBE2C and protects glioma cells from autophagic death. Cell Cycle 2017 Aug 2 [PMID: 28767320]
Castelblanco E, Zafon C, Maravall J et al. APLP2, RRM2 and PRC1: new putative markers for the differential diagnosis of thyroid follicular lesions. Thyroid 2016 Oct 31 [PMID: 27796194]
Chou Chen-Pin, Huang Nan-Chieh, Jhuang Shu-Jhen et al. Ubiquitin-conjugating enzyme UBE2C is highly expressed in breast microcalcification lesions. PLoS One. 2014 Apr 03 [PMID: 24699941] (WB, Human) WB Human
Guo JC, Li J, Yang YC et al. Oligonucleotide Microarray Identifies Genes Differentially Expressed during Tumorigenesis of DMBA-Induced Pancreatic Cancer in Rats. PLoS One. 2013 Dec 23 [PMID: 24376604]
Morikawa T, Kawai T, Abe H et al. UBE2C is a marker of unfavorable prognosis in bladder cancer after radical cystectomy. Int J Clin Exp Pathol. 2013 Jun 15 [PMID: 23826418]
Fristrup N, Birkenkamp-Demtroder K, Reinert T et al. Multicenter Validation of Cyclin D1, MCM7, TRIM29, and UBE2C as Prognostic Protein Markers in Non-Muscle Invasive Bladder Cancer. Am J Pathol. 2012 Nov 28 [PMID: 23201130]
Jiang L, Wang T, Bao Y et al. A study of UbcH10 expression and its association with recurrence of meningiomas. J Surg Oncol. 2011 Nov 17 [PMID: 22095464]
Chen S, Chen Y, Hu C, et al. Association of clinicopathological features with UbcH10 expression in colorectal cancer. J Cancer Res Clin Oncol. 2009 Sep 25. [PMID: 19779934]
Show All 11 Publications.

Reviews for UbcH10/UBE2C Antibody (H00011065-M01) (0)

There are no reviews for UbcH10/UBE2C Antibody (H00011065-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UbcH10/UBE2C Antibody (H00011065-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional UbcH10/UBE2C Products

Bioinformatics Tool for UbcH10/UBE2C Antibody (H00011065-M01)

Discover related pathways, diseases and genes to UbcH10/UBE2C Antibody (H00011065-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UbcH10/UBE2C Antibody (H00011065-M01)

Discover more about diseases related to UbcH10/UBE2C Antibody (H00011065-M01).
 

Pathways for UbcH10/UBE2C Antibody (H00011065-M01)

View related products by pathway.

PTMs for UbcH10/UBE2C Antibody (H00011065-M01)

Learn more about PTMs related to UbcH10/UBE2C Antibody (H00011065-M01).
 

Research Areas for UbcH10/UBE2C Antibody (H00011065-M01)

Find related products by research area.

Blogs on UbcH10/UBE2C

There are no specific blogs for UbcH10/UBE2C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UbcH10/UBE2C Antibody (9D3) and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2C
Entrez
OMIM
Uniprot