UbcH10/UBE2C Antibody (9D3) - Azide and BSA Free

Western Blot: UbcH10/UBE2C Antibody (9D3) [H00011065-M01] - UBE2C monoclonal antibody (M01), clone 9D3 Analysis of UBE2C expression in HeLa.

Immunocytochemistry/Immunofluorescence: UbcH10/UBE2C Antibody (9D3) [H00011065-M01] - Analysis of monoclonal antibody to UBE2C on HeLa cell. Antibody concentration 10 ug/ml.

Immunohistochemistry-Paraffin: UbcH10/UBE2C Antibody (9D3) [H00011065-M01] - Analysis of monoclonal antibody to UBE2C on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml.

Western Blot: UbcH10/UBE2C Antibody (9D3) [H00011065-M01] - Analysis of UBE2C expression in transfected 293T cell line by UBE2C monoclonal antibody (M01), clone 9D3.Lane 1: UBE2C transfected lysate(19.7 KDa).Lane 2: Non-transfected lysate.

ELISA: UbcH10/UBE2C Antibody (9D3) [H00011065-M01] - Detection limit for recombinant GST tagged UBE2C is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 9D3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

UbcH10/UBE2C Antibody (9D3) - Azide and BSA Free Summary

• Immunogen: UBE2C (NP_008950, 70 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
• Localization: Nuclear
• Specificity: UBE2C - ubiquitin-conjugating enzyme E2C
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: UBE2C
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UbcH10/UBE2C Antibody (9D3) - Azide and BSA Free

• cyclin-selective ubiquitin carrier protein
• dJ447F3.2
• EC 6.3.2.19
• UbcH10
• UBCH10mitotic-specific ubiquitin-conjugating enzyme
• UBE2C
• Ubiquitin carrier protein C
• ubiquitin carrier protein E2-C
• ubiquitin-conjugating enzyme E2 C
• ubiquitin-conjugating enzyme E2C
• Ubiquitin-protein ligase C

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for the destruction of mitotic cyclins and for cell cycle progression. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for UbcH10/UBE2C Antibody (H00011065-M01)(13)

Publications using H00011065-M01

• An-Jen C, Chia-Jung L, Kuan-Hao T et al. UBE2C Drives Human Cervical Cancer Progression and Is Positively Modulated by mTOR. Biomolecules. 2020-12-30 [PMID: 33396624]
• Pei-Feng L, Chun-Feng C, Chih-Wen S et al. UBE2C is a Potential Biomarker for Tumorigenesis and Prognosis in Tongue Squamous Cell Carcinoma. Diagnostics (Basel). 2020-09-04 [PMID: 32899896]
• Lin SL, Yeh JL, Tsai PC et al. Inhibition of Neointima Hyperplasia, Inflammation, and Reactive Oxygen Species in Balloon-Injured Arteries by HVJ Envelope Vector-Mediated Delivery of Superoxide Dismutase Gene. Transl Stroke Res 2018-09-06 [PMID: 30191468]
• Mo CH, Gao L, Zhu XF et al. The clinicopathological significance of UBE2C in breast cancer: a study based on immunohistochemistry, microarray and RNA-sequencing data. Cancer Cell Int 2017-09-25 [PMID: 29021715]
• Guo L, Ding Z, Huang N et al. Forkhead Box M1 positively regulates UBE2C and protects glioma cells from autophagic death. Cell Cycle 2017-08-02 [PMID: 28767320]
• Castelblanco E, Zafon C, Maravall J et al. APLP2, RRM2 and PRC1: new putative markers for the differential diagnosis of thyroid follicular lesions. Thyroid 2016-10-31 [PMID: 27796194]
• Chou Chen-Pin, Huang Nan-Chieh, Jhuang Shu-Jhen et al. Ubiquitin-conjugating enzyme UBE2C is highly expressed in breast microcalcification lesions. PLoS One. 2014-04-03 [PMID: 24699941] (WB, Human)
• Guo JC, Li J, Yang YC et al. Oligonucleotide Microarray Identifies Genes Differentially Expressed during Tumorigenesis of DMBA-Induced Pancreatic Cancer in Rats. PLoS One. 2013-12-23 [PMID: 24376604]
• Morikawa T, Kawai T, Abe H et al. UBE2C is a marker of unfavorable prognosis in bladder cancer after radical cystectomy. Int J Clin Exp Pathol. 2013-06-15 [PMID: 23826418]
• Fristrup N, Birkenkamp-Demtroder K, Reinert T et al. Multicenter Validation of Cyclin D1, MCM7, TRIM29, and UBE2C as Prognostic Protein Markers in Non-Muscle Invasive Bladder Cancer. Am J Pathol. 2012-11-28 [PMID: 23201130]
• Jiang L, Wang T, Bao Y et al. A study of UbcH10 expression and its association with recurrence of meningiomas. J Surg Oncol. 2011-11-17 [PMID: 22095464]
• Chen S, Chen Y, Hu C, et al. Association of clinicopathological features with UbcH10 expression in colorectal cancer. J Cancer Res Clin Oncol. 2009-09-25 [PMID: 19779934]
• Jiang L, Huang CG, Lu YC et al. Expression of ubiquitin-conjugating enzyme E2C/UbcH10 in astrocytic tumors. Brain Res;1201:161-6. 2008-03-27 [PMID: 18331723]

Bioinformatics

• Gene Symbol: UBE2C
• Entrez:
  • 11065(Human)
• OMIM:
  • 605574(Human)
• Uniprot:
  • NP_008950(Human)