UbcH7/UBE2L3 Antibody

Images

 
Western Blot: UbcH7/UBE2L3 Antibody [NBP2-49367] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane ...read more
Immunocytochemistry/ Immunofluorescence: UbcH7/UBE2L3 Antibody [NBP2-49367] - Staining of human cell line A-431 shows localization to nucleus & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: UbcH7/UBE2L3 Antibody [NBP2-49367] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UbcH7/UBE2L3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: CLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
Specificity
Specificity of human UbcH7/UBE2L3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBE2L3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UbcH7/UBE2L3 Recombinant Protein Antigen (NBP2-49367PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UbcH7/UBE2L3 Antibody

  • E2-F1
  • EC 6.3.2.19
  • L-UBC
  • UBCE7
  • UbcH7
  • UBCH7UbcM4
  • UbcM4
  • UBE2L3
  • Ubiquitin carrier protein L3
  • ubiquitin-conjugating enzyme E2 L3
  • Ubiquitin-conjugating enzyme E2-F1
  • ubiquitin-conjugating enzyme E2L 3
  • ubiquitin-conjugating enzyme UBCH7
  • Ubiquitin-protein ligase L3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-45402
Species: Hu
Applications: WB, Flow, IHC
NB500-240
Species: Hu, Mu
Applications: WB, IP
E2-616
Species: Hu
NBP1-92556
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-04351
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-86588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88984
Species: Hu
Applications: WB, IHC, IHC-P
E2-622
Species: Hu
NBP2-03523
Species: Hu, Ca
Applications: WB, Flow
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46278
Species: Hu
Applications: WB, IHC, IF
NBP2-31363
Species: Hu
Applications: WB, ICC/IF
NBP1-81988
Species: Hu
Applications: IHC, IHC-P

Publications for UbcH7/UBE2L3 Antibody (NBP2-49367) (0)

There are no publications for UbcH7/UBE2L3 Antibody (NBP2-49367).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UbcH7/UBE2L3 Antibody (NBP2-49367) (0)

There are no reviews for UbcH7/UBE2L3 Antibody (NBP2-49367). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UbcH7/UBE2L3 Antibody (NBP2-49367) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for UbcH7/UBE2L3 Antibody (NBP2-49367)

Discover related pathways, diseases and genes to UbcH7/UBE2L3 Antibody (NBP2-49367). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UbcH7/UBE2L3 Antibody (NBP2-49367)

Discover more about diseases related to UbcH7/UBE2L3 Antibody (NBP2-49367).
 

Pathways for UbcH7/UBE2L3 Antibody (NBP2-49367)

View related products by pathway.

PTMs for UbcH7/UBE2L3 Antibody (NBP2-49367)

Learn more about PTMs related to UbcH7/UBE2L3 Antibody (NBP2-49367).
 

Research Areas for UbcH7/UBE2L3 Antibody (NBP2-49367)

Find related products by research area.

Blogs on UbcH7/UBE2L3

There are no specific blogs for UbcH7/UBE2L3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UbcH7/UBE2L3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2L3
Entrez