UAF1/WDR48 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human UAF1/WDR48. Peptide sequence: NESQTTSSSNNEKPGEQEKEEDIAVLAEEKIELLCQDQVLDPNMDLRTVK The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
WDR48 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for UAF1/WDR48 Antibody - BSA Free
Background
Regulator of deubiquitinating complexes. Acts as a strong activator of USP1 by enhancing the USP1-mediateddeubiquitination of FANCD2; USP1 being almost inactive by itself. Also activates deubiquitinating activity ofcomplexes containing USP12 and USP46, respectively. Activates deubiquitination by increasing the catalytic turnoverwithout increasing the affinity of deubiquitinating enzymes for the substrate. In case of infection by Herpesvirussaimiri, may play a role in vesicular transport or membrane fusion events necessary for transport to lysosomes.Induces lysosomal vesicle formation via interaction with Herpesvirus saimiri tyrosine kinase-interacting protein(TIP). Subsequently, TIP recruits tyrosine-protein kinase LCK, resulting in down-regulation of T-cell antigen receptorTCR. May play a role in generation of enlarged endosomal vesicles via interaction with TIP. In case of infection bypapillomavirus HPV11, promotes the maintenance of the viral genome via its interaction with HPV11 helicase E1
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Species: Ha, Hu, Mu, Rt
Applications: ChIP, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB
Publications for UAF1/WDR48 Antibody (NBP2-86035) (0)
There are no publications for UAF1/WDR48 Antibody (NBP2-86035).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for UAF1/WDR48 Antibody (NBP2-86035) (0)
There are no reviews for UAF1/WDR48 Antibody (NBP2-86035).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for UAF1/WDR48 Antibody (NBP2-86035) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional UAF1/WDR48 Products
Research Areas for UAF1/WDR48 Antibody (NBP2-86035)
Find related products by research area.
|
Blogs on UAF1/WDR48