TYKi Antibody - Azide and BSA Free Summary
| Immunogen |
CMPK2 (NP_997198, 151 a.a. - 250 a.a.) partial recombinant protein with GST tag. GACQEAPRPHLGEFEADPRGQLWQRLWEVQDGRRLQVGCAQVVPVPEPPLHPVVPDLPSSVVFPDREAARAVLEECTSFIPEARAVLDLVDQCPKQIQKG |
| Specificity |
LOC129607 - hypothetical protein LOC129607 |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
CMPK2 |
| Purity |
Unpurified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA 1:100-1:2000
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
50% Glycerol |
| Preservative |
No Preservative |
| Purity |
Unpurified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for TYKi Antibody - Azide and BSA Free
Background
Mitochondrial UMP-CMP kinase (EC 2.7.2.14) is a component of the salvage pathway for nucleotide synthesis. Other enzymes of the salvage pathway include thymidine kinase-2 (TK2; MIM 188250), deoxynucleotidase-2 (NT5M; MIM 605292), deoxyguanosine kinase (DGUOK; MIM 601465), adenylate kinase-2 (AK2; MIM 103020), adenylate kinase-3 (AK3; MIM 609290), adenylate kinase-3-like-1 (AK3L1; MIM 103030), and nucleoside diphosphate kinase (NME4; MIM 601818) (Xu et al., 2008 [PubMed 17999954]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Ch, ChHa, Eq, Hu, Mu, Po, Pm, Rb, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Hu
Applications: CyTOF-ready, Flow, IP
Species: Mu
Applications: ELISA
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu, Pm
Applications: Flow, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: Flow, IHC, IHC-P
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, ELISA
Publications for TYKi Antibody (H00129607-A01) (0)
There are no publications for TYKi Antibody (H00129607-A01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TYKi Antibody (H00129607-A01) (0)
There are no reviews for TYKi Antibody (H00129607-A01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TYKi Antibody (H00129607-A01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TYKi Products
Research Areas for TYKi Antibody (H00129607-A01)
Find related products by research area.
|
Blogs on TYKi