TXNL1 Antibody (1A10)

Images

 
Western Blot: TXNL1 Antibody (1A10) [H00009352-M01] - TXNL1 monoclonal antibody (M01), clone 1A10 Analysis of TXNL1 expression in HL-60.
Sandwich ELISA: TXNL1 Antibody (1A10) [H00009352-M01] - Detection limit for recombinant GST tagged TXNL1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, S-ELISA
Clone
1A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TXNL1 Antibody (1A10) Summary

Immunogen
TXNL1 (AAH01156, 190 a.a. ~ 289 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQNVNSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRVVGKKGESH
Localization
Cytoplasmic
Specificity
TXNL1 - thioredoxin-like 1
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TXNL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Control
TXNL1 Knockout 293T Cell Lysate
Publications
Read Publication using H00009352-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TXNL1 Antibody (1A10)

  • 32 kDa thioredoxin-related protein
  • thioredoxin-like 1
  • thioredoxin-like, 32kDa
  • thioredoxin-related 32 kDa protein
  • thioredoxin-related protein 1
  • TRP32thioredoxin-like protein 1
  • Txl
  • TXL-1
  • TXNL

Background

Thioredoxins are a group of small redox active proteins which have a conserved active site sequence. The predicted 32.3-kD protein of TXNL1 (Thioredoxin like protein 1) has 2 distinct domains: an N terminal domain, which is 43% identical to human TXN, and a C terminal domain, which showed no homology to other proteins in the sequence databases. The active site sequence, located within the N terminal domain, is that of a thioredoxin like protein; compared to the active site sequence of TXN, it has a single amino acid substitution. Unlike other thioredoxin like proteins, TXNL1 did not act as a substrate for thioredoxin reductase in an insulin assay.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52983
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF6108
Species: Hu
Applications: IHC
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KO
NBP1-28566
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, Func, IHC, IHC-Fr
NBP2-34594
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
AF4478
Species: Hu
Applications: WB, IHC
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-80870
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP2-20619
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88370
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00009352-M01
Species: Hu
Applications: WB, ELISA, IHC, S-ELISA

Publications for TXNL1 Antibody (H00009352-M01)(1)

Reviews for TXNL1 Antibody (H00009352-M01) (0)

There are no reviews for TXNL1 Antibody (H00009352-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TXNL1 Antibody (H00009352-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TXNL1 Products

Bioinformatics Tool for TXNL1 Antibody (H00009352-M01)

Discover related pathways, diseases and genes to TXNL1 Antibody (H00009352-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TXNL1 Antibody (H00009352-M01)

Discover more about diseases related to TXNL1 Antibody (H00009352-M01).
 

Pathways for TXNL1 Antibody (H00009352-M01)

View related products by pathway.

PTMs for TXNL1 Antibody (H00009352-M01)

Learn more about PTMs related to TXNL1 Antibody (H00009352-M01).
 

Research Areas for TXNL1 Antibody (H00009352-M01)

Find related products by research area.

Blogs on TXNL1

There are no specific blogs for TXNL1, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TXNL1 Antibody (1A10) and receive a gift card or discount.

Bioinformatics

Gene Symbol TXNL1
Entrez
OMIM
Uniprot