We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human Twist-1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Twist-1 Protein [H00007291-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related Twist-1 Peptides and Proteins

Order Details


    • Catalog Number
      H00007291-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Twist-1 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-202 of Human TWIST1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGVGGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
TWIST1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
47.85 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Twist-1 GST (N-Term) Protein

  • acrocephalosyndactyly 3
  • ACS3
  • B-HLH DNA binding protein
  • BHLHA38
  • bHLHa38BPES3
  • BPES3
  • Class A basic helix-loop-helix protein 38
  • CRS1
  • H-twist
  • H-twistblepharophimosis, epicanthus inversus and ptosis 3
  • SCSBPES2
  • twist homolog 1 (Drosophila)
  • TWIST homolog of drosophila
  • TWIST
  • Twist1
  • Twist-1
  • twist-related protein 1

Background

Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation. The protein encoded by this gene is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Dermo1. The strongest expression of this mRNA is in placental tissue; in adults, mesodermally derived tissues express this mRNA preferentially. Mutations in this gene have been found in patients with Saethre-Chotzen syndrome. TWIST1( AAH36704, 1 a.a. - 203 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-25538
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
NBP2-03886
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
H00117581-M01
Species: Hu, Mu
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-00932
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-48309
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
AF3639
Species: Hu
Applications: ChIP, ICC, ICFlow, WB
NBP2-66840
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-82991
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-03644
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-05987
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC,  IHC-P, IP, KD, MiAr, Simple Western, Single-Cell Western, WB
H00007291-P01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for Twist-1 Full Length Recombinant Protein (H00007291-P01) (0)

There are no publications for Twist-1 Full Length Recombinant Protein (H00007291-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Twist-1 Full Length Recombinant Protein (H00007291-P01) (0)

There are no reviews for Twist-1 Full Length Recombinant Protein (H00007291-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Twist-1 Full Length Recombinant Protein (H00007291-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Twist-1 Products

Research Areas for Twist-1 Full Length Recombinant Protein (H00007291-P01)

Find related products by research area.

Blogs on Twist-1.

Autophagy and Metastasis
  By Christina Towers, PhD The majority of cancer patients die from metastatic disease at secondary sites. The threshold to undergo metastasis is high. Only a minority of cancer cells acquire invasive phenotypes...  Read full blog post.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Twist-1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TWIST1