TUT1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TUT1 Antibody [NBP2-57861] - Staining of human cell line HaCaT shows localization to nucleus & cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TUT1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LASPQSLPPASPLLEDREEGDLGKASELAETPKEEKAEGAAMLELVGSILRGCVPGVYRVQTVPSARRPVVKFCHRPSGLHGD
Specificity
Specificity of human TUT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TUT1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TUT1 Recombinant Protein Antigen (NBP2-57861PEP)

Reactivity Notes

Mouse 81%, Rat 80%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TUT1 Antibody

  • EC 2.7.7.19
  • EC 2.7.7.52
  • FLJ21850
  • FLJ22267
  • FLJ22347
  • MGC131987
  • MGC149809
  • nuclear speckle targeted phosphatidylinositol 4-phosphate 5-kinase type I-alpharegulated-poly(A) polymerase
  • nuclear speckle-targeted PIPK1A-regulated-poly(A) polymerase
  • PAP-associated domain-containing 2
  • PAPD2
  • poly(A) polymerase associated domain containing 2
  • RBM21
  • RNA binding motif protein 21
  • RNA uridylyltransferase
  • RNA-binding motif protein 21
  • RNA-binding protein 21
  • speckle targeted PIP5K1A-regulated poly(A) polymerase
  • STARPAP
  • star-PAP
  • terminal uridylyl transferase 1, U6 snRNA-specific
  • TUTase
  • U6 snRNA-specific terminal uridylyltransferase 1
  • U6 TUTase
  • U6-TUTase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43686
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3757
Species: Hu
Applications: WB, ICC
NBP1-87372
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-49142
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP1-03349
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24643
Species: Mu, Rt
Applications: WB
AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24566
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82257
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP3-04411
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-84476
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57861
Species: Hu
Applications: ICC/IF

Publications for TUT1 Antibody (NBP2-57861) (0)

There are no publications for TUT1 Antibody (NBP2-57861).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TUT1 Antibody (NBP2-57861) (0)

There are no reviews for TUT1 Antibody (NBP2-57861). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TUT1 Antibody (NBP2-57861) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TUT1 Products

Array NBP2-57861

Bioinformatics Tool for TUT1 Antibody (NBP2-57861)

Discover related pathways, diseases and genes to TUT1 Antibody (NBP2-57861). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TUT1 Antibody (NBP2-57861)

View related products by pathway.

Blogs on TUT1

There are no specific blogs for TUT1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TUT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TUT1