TUT1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TUT1 Antibody [NBP2-57861] - Staining of human cell line HaCaT shows localization to nucleus & cytosol. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TUT1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TUT1 Antibody - BSA Free (NBP2-57861) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LASPQSLPPASPLLEDREEGDLGKASELAETPKEEKAEGAAMLELVGSILRGCVPGVYRVQTVPSARRPVVKFCHRPSGLHGD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TUT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TUT1 Recombinant Protein Antigen (NBP2-57861PEP)

Reactivity Notes

Mouse 81%, Rat 80%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TUT1 Antibody - BSA Free

• EC 2.7.7.19
• EC 2.7.7.52
• FLJ21850
• FLJ22267
• FLJ22347
• MGC131987
• MGC149809
• nuclear speckle targeted phosphatidylinositol 4-phosphate 5-kinase type I-alpharegulated-poly(A) polymerase
• nuclear speckle-targeted PIPK1A-regulated-poly(A) polymerase
• PAP-associated domain-containing 2
• PAPD2
• poly(A) polymerase associated domain containing 2
• RBM21
• RNA binding motif protein 21
• RNA uridylyltransferase
• RNA-binding motif protein 21
• RNA-binding protein 21
• speckle targeted PIP5K1A-regulated poly(A) polymerase
• STARPAP
• star-PAP
• terminal uridylyl transferase 1, U6 snRNA-specific
• TUTase
• U6 snRNA-specific terminal uridylyltransferase 1
• U6 TUTase
• U6-TUTase

Background

The TUT1 gene encodes a nucleotidyl transferase that functions as both a terminal uridylyltransferase and a nuclear poly(A)polymerase. The encoded enzyme specifically adds and removes nucleotides from the 3' end of small nuclear RNAsand select mRNAs and may f

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TUT1