Tumstatin/COL4A3 Antibody - BSA Free

Western Blot: Tumstatin/COL4A3 Antibody [NBP3-02967] - Western blot analysis of extracts of Mouse kidney, using Tumstatin/COL4A3 antibody (NBP3-02967) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.

Immunocytochemistry/Immunofluorescence: Tumstatin/COL4A3 Antibody [NBP3-02967] - Analysis of NIH/3T3 cells using Tumstatin/COL4A3 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: Tumstatin/COL4A3 Antibody [NBP3-02967] - Analysis of HeLa cells using Tumstatin/COL4A3 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Tumstatin/COL4A3 Antibody - Azide and BSA Free [NBP3-02967] - Immunofluorescence analysis of PC-12 cells using Tumstatin/COL4A3 Rabbit pAb (A16359) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Tumstatin/COL4A3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Tumstatin/COL4A3 Antibody - BSA Free (NBP3-02967) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1555-1669 of human Tumstatin/COL4A3 (NP_000082.2). AIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKKR
• Specificity: Possible crossreactivity to whole COL4A3 molecule.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COL4A3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 162 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for Tumstatin/COL4A3 Antibody - BSA Free

• COL4A3
• collagen alpha-3(IV) chain
• collagen IV, alpha-3 polypeptide
• collagen, type IV, alpha 3 (Goodpasture antigen)
• Goodpasture antigen
• Tumstatin

Background

COL4A3 (Collagen, type IV, alpha 3) belongs to the type IV collagen family. Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Type IV collagen is a multimeric protein composed of 3 alpha subunits. These subunits are encoded by 6 different genes, alpha 1 through alpha 6, each of which can form a triple helix structure with 2 other subunits to form type IV collagen. Tumstatin, a cleavage fragment corresponding to the collagen alpha 3(IV) NC1 domain, possesses both anti-angiogenic and anti-tumor cell activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COL4A3