TULA/STS-2 Antibody - BSA Free

Staining of human cell line JURKAT shows localization to nucleoplasm.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TULA/STS-2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TULA/STS-2 Antibody - BSA Free (NBP3-25210) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein TULA/STS-2 using the following amino acid sequence: KSVLVVRHGERVDQIFGKAWLQQCSTPDGKYYRPDLNFPCSLPRRSRGIKDFENDPPLSSCGIFQSRIA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UBASH3A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TULA/STS-2 Antibody - BSA Free

• Cbl-interacting protein 4
• gene similar to UBA containing SH3 domain10CLIP4STS-2T-cell ubiquitin ligand protein
• STS2
• Suppressor of T-cell receptor signaling 2
• T-cell ubiquitin ligand
• TULAubiquitin-associated and SH3 domain-containing protein A
• ubiquitin associated and SH3 domain containing A

Background

UBASH3A, ubiquitin associated and SH3 domain containing, A, interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. Promotes accumulation of activated target receptors, such as T-cell receptors, EGFR and PDGFRB, on the cell surface (referenced from Swiss Prot).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UBASH3A