Tubulin Beta 4 Antibody - BSA Free

Western Blot: Tubulin Beta 4 Antibody [NBP1-57005] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Tubulin Beta 4 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to TUBB4 (tubulin, beta 4) The peptide sequence was selected from the N terminal of TUBB4. Peptide sequence TYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQI. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TUBB4A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1.0 ug/ml
• Application Notes: Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 28614796).

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28614796).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Tubulin Beta 4 Antibody - BSA Free

• TUBB4
• TUBB4A
• TUBB5beta-5
• Tubulin 5 beta
• Tubulin Beta 4
• tubulin beta-4 chain
• tubulin, beta 4
• tubulin, beta, 5

Background

Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Tubulin Beta 4 Antibody (NBP1-57005)(2)

Publications using NBP1-57005

• Zhong Y, Lee K, Deng Y et al. Arctigenin attenuates diabetic kidney disease through the activation of PP2A in podocytes Nat Commun 2019-10-04 [PMID: 31586053] (WB, Human)
• Chandra R, Hiniker A, Kuo YM et al. alpha-Synuclein in gut endocrine cells and its implications for Parkinson's disease. JCI Insight. 2017-06-15 [PMID: 28614796] (ICC/IF, Mouse)

Bioinformatics

• Gene Symbol: TUBB4A
• Uniprot:
  • P04350(Human)