Tubulin alpha-1B Antibody (ARC51243)

Western Blot: Tubulin alpha-1B Antibody [NBP3-23538] - Western blot analysis of lysates from HeLa cells, using Tubulin alpha-1B Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 0.5s.

Immunocytochemistry/ Immunofluorescence: Tubulin alpha-1B Antibody (ARC51243) [NBP3-23538] - Confocal imaging of HeLa cells using alpha -Tubulin Rabbit mAb(Green). The cells were counterstained with RAB11A Rabbit mAb. DAPI was used for nuclear staining (blue). Objective: 60x.

Immunohistochemistry: Tubulin alpha-1B Antibody [NBP3-23538] - Immunohistochemistry analysis of Tubulin alpha-1B in paraffin-embedded rat colon tissue using Tubulin alpha-1B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Tubulin alpha-1B Antibody [NBP3-23538] - Immunohistochemistry analysis of Tubulin alpha-1B in paraffin-embedded human cervix cancer tissue using Tubulin alpha-1B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Tubulin alpha-1B Antibody [NBP3-23538] - Immunohistochemistry analysis of Tubulin alpha-1B in paraffin-embedded mouse testis tissue using Tubulin alpha-1B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Tubulin alpha-1B Antibody [NBP3-23538] - Immunohistochemistry analysis of Tubulin alpha-1B in paraffin-embedded human colon carcinoma tissue using Tubulin alpha-1B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Tubulin alpha-1B Antibody [NBP3-23538] - Immunohistochemistry analysis of Tubulin alpha-1B in paraffin-embedded human tonsil tissue using Tubulin alpha-1B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Tubulin alpha-1B Antibody [NBP3-23538] - Immunohistochemistry analysis of Tubulin alpha-1B in paraffin-embedded mouse kidney tissue using Tubulin alpha-1B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: ARC51243
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Tubulin alpha-1B Antibody (ARC51243) Summary

• Description: Novus Biologicals Rabbit Tubulin alpha-1B Antibody (ARC51243) (NBP3-23538) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-42 of human alpha Tubulin(NP_006073.2, P68363).
• Epitope: MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI
• Localization: cytoplasm, cytoplasmic microtubule, microtubule cytoskeleton
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TUBA1B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Tubulin alpha-1B Antibody (ARC51243)

• alpha tubulin
• Alpha-tubulin ubiquitous
• K-ALPHA-1
• tubulin alpha-1B chain
• Tubulin alpha-ubiquitous chain
• Tubulin K-alpha-1
• tubulin, alpha 1b
• tubulin, alpha, ubiquitous

Background

Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TUBA1B