TUBA6 Antibody (S11)

Images

 
Western Blot: TUBA6 Antibody (S11) [H00084790-M04] - Analysis of TUBA6 expression in HeLa (Cat # L013V1).
Immunocytochemistry/ Immunofluorescence: TUBA6 Antibody (S11) [H00084790-M04] - Analysis of monoclonal antibody to TUBA6 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: TUBA6 Antibody (S11) [H00084790-M04] - Detection limit for recombinant GST tagged TUBA6 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
S11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TUBA6 Antibody (S11) Summary

Immunogen
TUBA6 (AAH04949, 1 a.a. ~ 450 a.a) full length recombinant protein with GST tag.MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI GGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYR QLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLA DQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLE FSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY DICRRNLDIERPTYTNLNRLISQIVSSITASLRFD
Specificity
TUBA6 - tubulin alpha 6
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TUBA1C
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TUBA6 Antibody (S11)

  • Alpha-tubulin 6
  • bcm948
  • MGC10851
  • MGC14580
  • TUBA6
  • tubulin alpha-1C chain
  • Tubulin alpha-6 chain
  • tubulin, alpha 1c
  • tubulin, alpha 6

Background

Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Fe, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NBP1-31004
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-690
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Dr, Fu, GP, Ha, Mk, Pa, Pm, Rb, Xp, Ye
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, CyTOF-ready, Flow-IC, IF
NB300-137
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
H00002023-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF8038
Species: Hu, Mu, Rt
Applications: WB
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-24488
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
NB100-1557
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-89483
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
H00023316-M03
Species: Hu
Applications: WB, ELISA
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
H00084790-M04
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for TUBA6 Antibody (H00084790-M04) (0)

There are no publications for TUBA6 Antibody (H00084790-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TUBA6 Antibody (H00084790-M04) (0)

There are no reviews for TUBA6 Antibody (H00084790-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TUBA6 Antibody (H00084790-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TUBA6 Antibody (H00084790-M04)

Discover related pathways, diseases and genes to TUBA6 Antibody (H00084790-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TUBA6 Antibody (H00084790-M04)

Discover more about diseases related to TUBA6 Antibody (H00084790-M04).
 

Pathways for TUBA6 Antibody (H00084790-M04)

View related products by pathway.

Blogs on TUBA6

There are no specific blogs for TUBA6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TUBA6 Antibody (S11) and receive a gift card or discount.

Bioinformatics

Gene Symbol TUBA1C
Entrez
Uniprot