TTP Antibody

Images

 
Western Blot: TTP Antibody [H00007538-D01P] - Analysis of ZFP36 expression in transfected 293T cell line by ZFP36 polyclonal antibody.Lane 1: ZFP36 transfected lysate(34.00 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: TTP Antibody [H00007538-D01P] - Analysis of antibody to ZFP36 on HeLa cell. Antibody concentration 20 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TTP Antibody Summary

Immunogen
ZFP36 (NP_003398.1, 1 a.a. - 326 a.a.) full-length human protein. MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE
Specificity
Reacts with zinc finger protein 36, C3H type, homolog (mouse).
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZFP36
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TTP Antibody

  • EZNFTranscription factor 17
  • HKL1Zinc finger protein eZNF
  • KID-1
  • KID1TCF-17
  • TCF17
  • zinc finger protein 354A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-26612
Species: Hu
Applications: IP (-), WB
AF4245
Species: Hu
Applications: WB, IP
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88667
Species: Hu
Applications: IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-07799
Species: Hu
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF4779
Species: Hu
Applications: WB, IHC
NBP1-92510
Species: Hu
Applications: IHC, IHC-P
H00001994-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TTP Antibody (H00007538-D01P) (0)

There are no publications for TTP Antibody (H00007538-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTP Antibody (H00007538-D01P) (0)

There are no reviews for TTP Antibody (H00007538-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TTP Antibody (H00007538-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TTP Products

Bioinformatics Tool for TTP Antibody (H00007538-D01P)

Discover related pathways, diseases and genes to TTP Antibody (H00007538-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTP Antibody (H00007538-D01P)

Discover more about diseases related to TTP Antibody (H00007538-D01P).
 

Pathways for TTP Antibody (H00007538-D01P)

View related products by pathway.

PTMs for TTP Antibody (H00007538-D01P)

Learn more about PTMs related to TTP Antibody (H00007538-D01P).

Blogs on TTP

There are no specific blogs for TTP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZFP36
Entrez
Uniprot