TTC39A Antibody - BSA Free

Analysis in human cell lines MCF-7 and PC-3 using Anti-TTC39A antibody. Corresponding TTC39A RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TTC39A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TTC39A Antibody - BSA Free (NBP1-88333) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YFSSNPISLPVPALEMMYIWNGYAVIGKQPKLTDGILEIITKAEEMLEKGPENEYSVDDECLVKLLKGLCLKYLG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TTC39A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TTC39A Protein (NBP1-88333PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TTC39A Antibody - BSA Free

• C1orf34
• chromosome 1 open reading frame 34
• DEME-6KIAA0452Differentially expressed in MCF7 with estradiol protein 6
• tetratricopeptide repeat domain 39A
• tetratricopeptide repeat protein 39A
• TPR repeat protein 39A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TTC39A