TTC39A Antibody


Immunohistochemistry: TTC39A Antibody [NBP1-88333] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

TTC39A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: YFSSNPISLPVPALEMMYIWNGYAVIGKQPKLTDGILEIITKAEEMLEKGPENEYSVDDECLVKLLKGLCLKYLG
Specificity of human TTC39A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TTC39A Protein (NBP1-88333PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (85%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TTC39A Antibody

  • C1orf34
  • chromosome 1 open reading frame 34
  • DEME-6KIAA0452Differentially expressed in MCF7 with estradiol protein 6
  • tetratricopeptide repeat domain 39A
  • tetratricopeptide repeat protein 39A
  • TPR repeat protein 39A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC-P
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Rb, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P

Publications for TTC39A Antibody (NBP1-88333) (0)

There are no publications for TTC39A Antibody (NBP1-88333).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTC39A Antibody (NBP1-88333) (0)

There are no reviews for TTC39A Antibody (NBP1-88333). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TTC39A Antibody (NBP1-88333) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TTC39A Products

Bioinformatics Tool for TTC39A Antibody (NBP1-88333)

Discover related pathways, diseases and genes to TTC39A Antibody (NBP1-88333). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTC39A Antibody (NBP1-88333)

Discover more about diseases related to TTC39A Antibody (NBP1-88333).

Blogs on TTC39A

There are no specific blogs for TTC39A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TTC39A Antibody and receive a gift card or discount.


Gene Symbol TTC39A