![Immunohistochemistry-Paraffin: TTBK1 Antibody [NBP1-82888] - Staining of human lymph node shows low positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/TTBK1-Antibody-Immunohistochemistry-Paraffin-NBP1-82888-img0017.jpg "Immunohistochemistry-Paraffin: TTBK1 Antibody [NBP1-82888] - Staining of human lymph node shows low positivity in non-germinal center cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RLVMEKRQGRLLLRLASGASSSSSEEQRRASETLSGTGSEEDTPASEPAAALPRKSGRAAATRSRIPRPIGLRMPMPVAAQQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TTBK1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Theoretical MW | 143 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TTBK1 Antibody (NBP1-82888)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: TTBK1 Antibody [NBP1-82888] - Analysis in human cerebral cortex and kidney tissues. Corresponding TTBK1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TTBK1-Antibody-Immunohistochemistry-Paraffin-NBP1-82888-img0014.jpg "Immunohistochemistry-Paraffin: TTBK1 Antibody [NBP1-82888] - Analysis in human cerebral cortex and kidney tissues. Corresponding TTBK1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: TTBK1 Antibody [NBP1-82888] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/TTBK1-Antibody-Immunohistochemistry-Paraffin-NBP1-82888-img0015.jpg "Immunohistochemistry-Paraffin: TTBK1 Antibody [NBP1-82888] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: TTBK1 Antibody [NBP1-82888] - Staining of human kidney shows low positivity as expected.](http://images.novusbio.com/fullsize/TTBK1-Antibody-Immunohistochemistry-Paraffin-NBP1-82888-img0016.jpg "Immunohistochemistry-Paraffin: TTBK1 Antibody [NBP1-82888] - Staining of human kidney shows low positivity as expected.")
![Immunohistochemistry-Paraffin: TTBK1 Antibody [NBP1-82888] - Staining of human placenta shows low positivity in trophoblastic cells as expected.](http://images.novusbio.com/fullsize/TTBK1-Antibody-Immunohistochemistry-Paraffin-NBP1-82888-img0018.jpg "Immunohistochemistry-Paraffin: TTBK1 Antibody [NBP1-82888] - Staining of human placenta shows low positivity in trophoblastic cells as expected.")
![N/A Lipocalin-2/NGAL [Biotin]](https://images.novusbio.com/images2/DATA_Lipocalin2_DY1857_ELISA_2306.jpg)
![Ficolin-2 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Ficolin-2 [Unconjugated]")
![Western Blot Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Western_Blot_5334.jpg)
![Immunohistochemistry Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Immunohistochemistry_10404.jpg)
![Simple Western Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Simple_Western_16649.jpg)
![SDS-PAGE IL-12 [Unconjugated]](https://images.novusbio.com/images2/IL-12_419-ML_403.jpg)
![Bioactivity IL-12 [Unconjugated]](https://images.novusbio.com/images2/IL-12_419-ML_405.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")