TSPAN8/TM4SF3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TSPAN8/TM4SF3 Antibody [NBP2-38529] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: TSPAN8/TM4SF3 Antibody [NBP2-38529] - Staining of human placenta shows very weak membranous positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: TSPAN8/TM4SF3 Antibody [NBP2-38529] - Staining of human colon shows high expression.

Immunohistochemistry-Paraffin: TSPAN8/TM4SF3 Antibody [NBP2-38529] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: TSPAN8/TM4SF3 Antibody [NBP2-38529] - Staining in human colon and liver tissues using anti-TSPAN8 antibody. Corresponding TSPAN8 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: TSPAN8/TM4SF3 Antibody [NBP2-38529] - Staining of human colon shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: TSPAN8/TM4SF3 Antibody [NBP2-38529] - Staining of human pancreas shows moderate membranous positivity in endocrine glandular cells.

Immunohistochemistry-Paraffin: TSPAN8/TM4SF3 Antibody [NBP2-38529] - Staining of human tonsil shows no membranous positivity in germinal center cells as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TSPAN8/TM4SF3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TSPAN8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TSPAN8/TM4SF3 Recombinant Protein Antigen (NBP2-38529PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TSPAN8/TM4SF3 Antibody - BSA Free

• CO-029
• tetraspanin 8
• TM4SF3
• TM4SF3tspan-8
• Transmembrane 4 superfamily member 3tetraspanin-8
• TSPAN8
• Tspan-8
• Tumor-associated antigen CO-029

Background

TM4SF3 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. TM4SF3 is known to complex with integrins. Its gene is expressed in different carcinomas. The use of alternate polyadenylation sites has been found for TM4SF3 gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TSPAN8
• Uniprot:
  • P19075(Human)