Western Blot: ADAMTS9 Antibody [NBP1-82916] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Staining of human placenta shows moderate cytoplasmic positivity in decidual cells.
Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.
Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.
Staining of human prostate shows no positivity in smooth muscle cells as expected.
ADAMTS9 knockout kidney organoids demonstrate abnormal cilia, and ciliogenesis is not rescued by overexpressing ADAMTS9 variants. (A) ADAMTS9 is localized near the basal bodies of primary cilia and co-localized with ...read more
ADAMTS9 knockout kidney organoids demonstrate abnormal cilia, and ciliogenesis is not rescued by overexpressing ADAMTS9 variants. (A) ADAMTS9 is localized near the basal bodies of primary cilia and co-localized with ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: VMCVNYSDHVIDRSECDQDYIPETDQDCSMSPCPQRTPDSGLAQHPFQNEDYRPRSASPSRTHVLGGNQWRTGPWGACSSTC
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAMTS9
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Mouse reactivity reported in scientific literature (PMID: 30609407). Immunogen displays the following percentage of sequence identity for non-tested species: Rat (83%)
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for ADAMTS9 Antibody - BSA Free
ADAM metallopeptidase with thrombospondin type 1 motif, 9
ADAMTS-9,9
FLJ42955
Background
ADAMTS proteases are secreted enzymes containing a prometalloprotease domain of the reprolysin type. The ADAMTS proteases function in processing of procollagens and von Willebrand factor as well as catabolism of aggrecan, versican and brevican. They have been demonstrated to have important roles in connective tissue organization, coagulation, inflammation, arthritis, angiogenesis and cell migration. ADAMTS9 is closest in homology to ADAMTS20, sharing 54% overall identity, and like ADAMTS20 ADAMTS9 gas a GON like domain at the carboxyterminal end. The GON domain at the carboxyterminal end is similar to the GON1 protein in C. elegans, mutations of which lead to defective gonadal development. ADAMTS9 is expressed in ovary and testis, but little is known about the role of ADAMTS9 in reproductive organs. ADAMTS9 is also expressed in the heart, placenta, lung, skeletal tissue, and pancreas, so the protein must have wider functions than just gonadal development. ADAMTS9, like ADAMTS20, has a total of 15 thrombospondin like domains. The first TS domain begins shortly after the catalytic and disintegrin domains. TS domains 2 to 6 follow a spacer domain, followed by linker domain 1, then TS domains 7 & 8, linker domain 2, and then TS domains 9 to 15. In other ADAMTS proteins the TS motifs are thought to bind to the ECM. The ADAMTS proteins contain at least one prohormone convertase cleavage site, although it appears that one site is used preferentially, and cleavage of the propeptide domain at this site generates active enzymes. For ADAMTS9, this site is the RRTKR sequence, and the mature ADAMTS9 has an aminoterminal sequence of FLSYPR. The catalytic site of ADAMTS9 is most like ADAMTS1, 14 and 15, with an HExxHVFNMxH sequence, perhaps giving these enzymes some shared specificity.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our ADAMTS9 Antibody - BSA Free and receive a gift card or discount.