TSPAN33 Antibody

Images

 
Western Blot: TSPAN33 Antibody [NBP1-74070] - Rat Brain lysate, concentration 1 ug/ml.

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TSPAN33 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Tspan33. Immunizing peptide sequence NTMCGQGMQALDYLEASKVIYTNGCIDKLVNWIHSNLFLLGGVALGLAIP. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TSPAN33
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Tspan33 and was validated on Western blot.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TSPAN33 Antibody

  • hPen
  • PEN
  • Penumbra
  • proerythroblast new membrane
  • tetraspanin 33
  • tetraspanin-33
  • TSPAN33
  • tspan-33

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
MAB6967
Species: Hu
Applications: WB
NB100-56708
Species: Ch, ChHa, Hu, Ma, Mu, Po, Rt
Applications: CyTOF-ready, EM, Flow, HEStain, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, KD, KO, Simple Western, WB
H00004154-M02
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NBP3-15868
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-31225
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81555
Species: Hu
Applications: IHC, IHC-P, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
NBP2-80405
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00347527-P01
Species: Hu
Applications: ELISA, AP, PA, WB

Publications for TSPAN33 Antibody (NBP1-74070) (0)

There are no publications for TSPAN33 Antibody (NBP1-74070).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSPAN33 Antibody (NBP1-74070) (0)

There are no reviews for TSPAN33 Antibody (NBP1-74070). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSPAN33 Antibody (NBP1-74070) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TSPAN33 Products

Bioinformatics Tool for TSPAN33 Antibody (NBP1-74070)

Discover related pathways, diseases and genes to TSPAN33 Antibody (NBP1-74070). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSPAN33 Antibody (NBP1-74070)

Discover more about diseases related to TSPAN33 Antibody (NBP1-74070).
 

Pathways for TSPAN33 Antibody (NBP1-74070)

View related products by pathway.

PTMs for TSPAN33 Antibody (NBP1-74070)

Learn more about PTMs related to TSPAN33 Antibody (NBP1-74070).

Blogs on TSPAN33

There are no specific blogs for TSPAN33, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSPAN33 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TSPAN33
Uniprot