TSPAN12 Antibody

Images

 
Western Blot: TSPAN12 Antibody [NBP2-49278] - Analysis in control (vector only transfected HEK293T lysate) and TSPAN12 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: TSPAN12 Antibody [NBP2-49278] - Staining of human small intestine shows membrane positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TSPAN12 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LMVPVQWSDMVTLKARMTNYGLPRYRWLTHAWNFFQREFKCCGVVYFTDWLEMTEMDWPPDSCCVREFPGCSKQAHQEDLSDLYQEGCGKKMY
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TSPAN12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TSPAN12 Recombinant Protein Antigen (NBP2-49278PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TSPAN12 Antibody

  • EVR5
  • Leukemia-associated protein with a CXXC domain
  • methylcytosine dioxygenase TET1
  • NET2
  • NET-2
  • ten-eleven translocation-1
  • tetraspanin-12
  • TM4SF12
  • TSPAN12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
AF3014
Species: Hu
Applications: Block, IHC, WB
AF6646
Species: Hu
Applications: WB
AF4779
Species: Hu
Applications: IHC, WB
MAB3446
Species: Hu
Applications: WB
NB500-327
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, In vitro, WB
NBP1-77260
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB4609
Species: Mu
Applications: CyTOF-ready, Flow, ICC
NBP2-67599
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-90310
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-13445
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
936-AD
Species: Hu
Applications: EnzAct
257-NT/CF
Species: Hu
Applications: BA
NBP2-94464
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00003654-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-45269
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-49278
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for TSPAN12 Antibody (NBP2-49278) (0)

There are no publications for TSPAN12 Antibody (NBP2-49278).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSPAN12 Antibody (NBP2-49278) (0)

There are no reviews for TSPAN12 Antibody (NBP2-49278). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSPAN12 Antibody (NBP2-49278) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TSPAN12 Products

Bioinformatics Tool for TSPAN12 Antibody (NBP2-49278)

Discover related pathways, diseases and genes to TSPAN12 Antibody (NBP2-49278). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSPAN12 Antibody (NBP2-49278)

Discover more about diseases related to TSPAN12 Antibody (NBP2-49278).
 

Pathways for TSPAN12 Antibody (NBP2-49278)

View related products by pathway.

PTMs for TSPAN12 Antibody (NBP2-49278)

Learn more about PTMs related to TSPAN12 Antibody (NBP2-49278).

Blogs on TSPAN12

There are no specific blogs for TSPAN12, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSPAN12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TSPAN12