Recombinant Human TSG101 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related TSG101 Peptides and Proteins

Order Details


    • Catalog Number
      H00007251-Q02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human TSG101 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 291-390 of Human TSG101

Source: Wheat Germ

Amino Acid Sequence: LKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTILYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TSG101
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TSG101 Protein

  • ESCRT-I complex subunit TSG101
  • TSG10
  • TSG101
  • tumor susceptibility gene 10
  • tumor susceptibility gene 101 protein
  • tumor susceptibility gene 101
  • tumor susceptibility protein
  • VPS23

Background

Tumor susceptibility 101 protein (human TSG101 theoretical molecular weight 44kDa) is the mammalian homologue of the yeast protein Vps23 which plays a role in endosomal and multivesicular body trafficking. TSG101 forms part of the endosomal sorting complexes required for transport complex 1 (ESCRT-I), a cytosolic multiprotein complex consisting additionally of Vps28, Vps37 (A-D) and Mvb12 (A, B) or UBAP1 (1). TSG101 contains multiple domains including the amino terminal ubiquitin e2 variant (UEV) domain, a proline-rich (RRR) domain, a coiled coil (CC) domain, and a carboxy terminal alpha-helical/steadiness box (SB) domain (2). As part of the ESCRT-I complex, TSG101 interacts through its UEV domain with ubiquitinated membrane proteins and members of the ESCRT-0 complex. The UEV domain plays a critical role for various TSG101 functions such as protein sorting into multivesicular bodies and late endosomes, and in the process of viral budding. For example, TSG101 interacts with the intermediate-conductance, Ca2+ -activated K+ channel (KCa3.1), facilitating its targeting to the lysosome for degradation (3). Additionally, TSG101 has been implicated in the turnover of connexins such as connexins 43 and 45 (4). TSG101 plays a role in other cellular functions including transcriptional regulation, cytokinesis and cell growth (2).

Upon its initial discovery, TSG101 was recognized as a tumor suppressor protein due to the identification of deletions within the TSG101 gene in human breast carcinomas. However, re-examination of the initial findings argued against this function and supported that TSG101 promotes tumorigenesis (2). In agreement with this role, TSG101 expression is upregulated in several types of cancer including breast, ovarian, and colorectal carcinoma.

References

1. Schmidt, O., & Teis, D. (2012). The ESCRT machinery. Current Biology. https://doi.org/10.1016/j.cub.2012.01.028

2. Jiang, Y., Ou, Y., & Cheng, X. (2013). Role of TSG101 in cancer. Frontiers in Bioscience. https://doi.org/10.2741/4099

3. Balut, C. M., Gao, Y., Murray, S. A., Thibodeau, P. H., & Devor, D. C. (2010). ESCRT-dependent targeting of plasma membrane localized KCa3.1 to the lysosomes. American Journal of Physiology - Cell Physiology. https://doi.org/10.1152/ajpcell.00120.2010

4. Su, V., & Lau, A. F. (2014). Connexins: Mechanisms regulating protein levels and intercellular communication. FEBS Letters. https://doi.org/10.1016/j.febslet.2014.01.013

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90201
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP1-83202
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-27784
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
H00006430-B01P
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89490
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-45412
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
236-EG
Species: Hu
Applications: BA
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
MAB6218
Species: Hu, Mu, Rt
Applications: WB
NBP1-71702
Species: Ch, Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-49557
Species: Hu
Applications: IHC,  IHC-P
MAB6015
Species: Hu, Mu, Rt
Applications: WB
AF7117
Species: Hu, Mu
Applications: ICC, IHC, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-91782
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-77198
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00007251-Q02
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for TSG101 Partial Recombinant Protein (H00007251-Q02) (0)

There are no publications for TSG101 Partial Recombinant Protein (H00007251-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSG101 Partial Recombinant Protein (H00007251-Q02) (0)

There are no reviews for TSG101 Partial Recombinant Protein (H00007251-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSG101 Partial Recombinant Protein (H00007251-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TSG101 Products

Research Areas for TSG101 Partial Recombinant Protein (H00007251-Q02)

Find related products by research area.

Blogs on TSG101.

Glypican 3 as a biomarker for gastro-esophageal adenocarcinoma
By Jamshed Arslan, Pharm. D., PhD. Gastroesophageal adenocarcinoma originates from the glandular epithelium of the esophagus, gastroesophageal junction and stomach. The incidence of gastroesophageal adenocarcinoma is ...  Read full blog post.

Tools for Isolation, Quantification and Analysis of Exosomes
Exosomes are spherical to cup-shaped bilayered membrane enclosed nanosize vesicles (30-100 nm) which have the ability to shuttle active cargoes between cells. Johnstone et al. 1987 pioneered in documenting the generation of exosomes in differentiat...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TSG101 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TSG101