Tryptophan hydroxylase 2 Recombinant Protein Antigen

Images

 
There are currently no images for Tryptophan hydroxylase 2 Recombinant Protein Antigen (NBP2-46646PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Tryptophan hydroxylase 2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TPH2.

Source: E. coli

Amino Acid Sequence: SITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQYLG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TPH2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-46646.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Tryptophan hydroxylase 2 Recombinant Protein Antigen

  • ADHD7
  • EC 1.14.16
  • EC 1.14.16.4
  • FLJ37295
  • MGC138872
  • Neuronal tryptophan hydroxylase
  • NTPH
  • NTPHMGC138871
  • TPH2
  • tryptophan 5-hydroxylase 2
  • Tryptophan 5-monooxygenase 2
  • Tryptophan Hydroxylase 2

Background

Tryptophan hydroxylase (TPH) catalyzes the 5-hydroxylation of tryptophan, which is the first step in the biosynthesis of indoleamines (serotonin and melatonin) (Martinez et al., 2001). In mammals, serotonin biosynthesis occurs predominantly in neurons which originate in the Raphe nuclei of the brain, and melatonin synthesis takes place within the pineal gland. Although TPH catalyzes the same reaction within the Raphe nuclei and the pineal gland, TPH activity is rate-limiting for serotonin but not melatonin biosynthesis. Serotonin functions mainly as a neurotransmitter, whereas melatonin is the principal hormone secreted by the pineal gland. The activity of TPH is enhanced by phosphorylation by cAMP-dependent protein kinase (PKA) and Ca2+/calmodulin kinase II (CaM K II) (Jiang et al., 2000; Johansen et al., 1996). CaM K II phosphorylates Ser260 which lies within the regulatory domain of TPH (Jiang et al., 2000).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86922
Species: Hu
Applications: IHC, IHC-P, WB
H00006532-D01P
Species: Hu, Mu
Applications: WB
NBP2-21590
Species: Hu, Mu
Applications: ICC/IF, IHC-Fr, Simple Western, WB
NBP2-38868
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DBD00
Species: Hu
Applications: ELISA
NB100-1780
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
NBP2-26091
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP3-23927
Species: Hu
Applications: IHC-P
NBP1-31528
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-31386
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
7570-GH
Species: Hu
Applications: EnzAct
H00001392-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-22164
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NBP1-47977
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-12251
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
AF3564
Species: Hu, Mu, Rt
Applications: ICC, IHC, IP, WB

Publications for Tryptophan hydroxylase 2 Recombinant Protein Antigen (NBP2-46646PEP) (0)

There are no publications for Tryptophan hydroxylase 2 Recombinant Protein Antigen (NBP2-46646PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tryptophan hydroxylase 2 Recombinant Protein Antigen (NBP2-46646PEP) (0)

There are no reviews for Tryptophan hydroxylase 2 Recombinant Protein Antigen (NBP2-46646PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Tryptophan hydroxylase 2 Recombinant Protein Antigen (NBP2-46646PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Tryptophan hydroxylase 2 Products

Research Areas for Tryptophan hydroxylase 2 Recombinant Protein Antigen (NBP2-46646PEP)

Find related products by research area.

Blogs on Tryptophan hydroxylase 2

There are no specific blogs for Tryptophan hydroxylase 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Tryptophan hydroxylase 2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TPH2