Tryptase beta-2/TPSB2 Antibody (6U1C5)

Western Blot: Tryptase beta-2/TPSB2 Antibody (6U1C5) [NBP3-15925] - Analysis of extracts of various cell lines, using Tryptase beta-2/TPSB2 (TPSB2) Rabbit mAb (NBP3-15925) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunohistochemistry: Tryptase beta-2/TPSB2 Antibody (6U1C5) [Tryptase beta-2/TPSB2] - Immunohistochemistry analysis of paraffin-embedded Human small intestine tissue using Tryptase beta-2/TPSB2 Rabbit mAb at a dilution of 1:40000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Tryptase beta-2/TPSB2 Antibody (6U1C5) [NBP3-15925] - Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using Tryptase beta-2/TPSB2 Rabbit mAb at a dilution of 1:40000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Tryptase beta-2/TPSB2 Antibody (6U1C5) [NBP3-15925] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using Tryptase beta-2/TPSB2 Rabbit mAb at a dilution of 1:40000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 6U1C5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Tryptase beta-2/TPSB2 Antibody (6U1C5) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-275 of human Tryptase beta-2/TPSB2 (TPSB2) (P20231). GIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TPSB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Tryptase beta-2/TPSB2 Antibody (6U1C5)

• EC 3.4.21
• EC 3.4.21.59
• mast cell tryptase beta II
• mast cell tryptase beta III
• TPS2
• TPS2tryptase beta-2
• TPSB2
• Tryptase alpha/beta-1
• tryptase beta 2 (gene/pseudogene)
• tryptase beta 2
• tryptase beta II
• tryptase beta III
• Tryptase beta2
• Tryptase beta-2
• Tryptase II
• tryptase III
• tryptase-2
• tryptaseB
• tryptaseC
• Tryptase-C

Background

Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. These genes are characterized by several distinct features. They have a highly conserved 3' UTR and contain tandem repeat sequences at the 5' flank and 3' UTR which are thought to play a role in regulation of the mRNA stability. These genes have an intron immediately upstream of the initiator Met codon, which separates the site of transcription initiation from protein coding sequence. This feature is characteristic of tryptases but is unusual in other genes. The alleles of this gene exhibit an unusual amount of sequence variation, such that the alleles were once thought to represent two separate genes, beta II and beta III. Beta tryptases appear to be the main isoenzymes expressed in mast cells, whereas in basophils, alpha-tryptases predominate. Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic and inflammatory disorders. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TPSB2