Trypsin 1/PRSS1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Trypsin 1/PRSS1 Antibody [NBP2-46871] - Analysis in human pancreas and cerebral cortex tissues using NBP2-46871 antibody. Corresponding PRSS1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Trypsin 1/PRSS1 Antibody [NBP2-46871] -Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: Trypsin 1/PRSS1 Antibody [NBP2-46871] -Staining of human duodenum shows strong cytoplasmic positivity in Paneth cells.

Immunohistochemistry-Paraffin: Trypsin 1/PRSS1 Antibody [NBP2-46871] -Staining of human cerebral cortex shows no positivity in neuronal cells as expected.

Immunohistochemistry-Paraffin: Trypsin 1/PRSS1 Antibody [NBP2-46871] -Staining of human tonsil shows no positivity in non-germinal center cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Trypsin 1/PRSS1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Trypsin 1/PRSS1 Antibody - BSA Free (NBP2-46871) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RIQVRLGEHNIEVLEGNEQFINAAKIIRHP
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRSS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Trypsin 1/PRSS1 Recombinant Protein Antigen (NBP2-46871PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Trypsin 1/PRSS1 Antibody - BSA Free

• Beta-trypsin
• Cationic trypsinogen
• digestive zymogen
• DKFZp779A0837
• EC 3.4.21
• EC 3.4.21.4
• FLJ57296
• MGC120175
• MGC149362
• nonfunctional trypsin 1
• protease, serine, 1 (trypsin 1)
• PRSS1
• PTRYI
• Serine protease 1
• TRP1
• TRY1beta-trypsin
• TRY4
• Trygn16
• TRYP1
• Trypsin 1
• Trypsin I
• trypsin-1
• Trypsinogen 1
• trypsinogen A

Background

Human Trypsin 1, encoded by the PRSS1 gene, is also known as cationic trypsinogen (1). Constituting approximately two-thirds of the total trypsin content in normal pancreatic juice, it is the most abundant trypsin isoform produced by the pancreas. It contains a signal peptide (residues 1-15), a pro region (residues 16-23), and a mature chain (residues 24-247). Trypsin 1 is synthesized in the pancreas and secreted into the duodenum lumen, where it is activated by enterokinase. Its major physiologic function is to digest food and to activate other pro-enzymes (2). Mutations in the PRSS1 gene can cause hereditary pancreatitis (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRSS1
• Entrez:
  • 5646(Human)
• Uniprot:
  • P07477()