Recombinant Human TRPV5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TRPV5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human TRPV5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGGFLPKAEGPGSQLQKLLPSFLVREQDWDQHLDKLHMLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAALYDNLEAALVLME

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TRPV5
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRPV5 Protein

  • Calcium transport protein 2
  • calcium transporter 2
  • CAT2
  • ECaC
  • ECAC1
  • ECAC1CaT2
  • Epithelial calcium channel 1CAT2
  • Osm-9-like TRP channel 3
  • OTRPC3
  • transient receptor potential cation channel subfamily V member 5
  • transient receptor potential cation channel, subfamily V, member 5
  • TRPV5

Background

TRPV5 - transient receptor potential cation channel, subfamily V, member 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-74138
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-90066
Species: Hu
Applications: WB, IHC, IHC-P
MAB8508
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56483
Species: Hu
Applications: ICC/IF
NBP2-35213
Species: Hu
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-78911
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF3320
Species: Hu
Applications: WB, IHC
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
NB110-74960
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00140803-R03
Species: Hu
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76511
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00056302-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TRPV5 Partial Recombinant Protein (H00056302-Q01) (0)

There are no publications for TRPV5 Partial Recombinant Protein (H00056302-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRPV5 Partial Recombinant Protein (H00056302-Q01) (0)

There are no reviews for TRPV5 Partial Recombinant Protein (H00056302-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRPV5 Partial Recombinant Protein (H00056302-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRPV5 Products

Bioinformatics Tool for TRPV5 Partial Recombinant Protein (H00056302-Q01)

Discover related pathways, diseases and genes to TRPV5 Partial Recombinant Protein (H00056302-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRPV5 Partial Recombinant Protein (H00056302-Q01)

Discover more about diseases related to TRPV5 Partial Recombinant Protein (H00056302-Q01).
 

Pathways for TRPV5 Partial Recombinant Protein (H00056302-Q01)

View related products by pathway.

PTMs for TRPV5 Partial Recombinant Protein (H00056302-Q01)

Learn more about PTMs related to TRPV5 Partial Recombinant Protein (H00056302-Q01).

Blogs on TRPV5

There are no specific blogs for TRPV5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

iNOS Antibody
NB300-605
TRPV5 Antibody
NB100-93520

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TRPV5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPV5
Entrez