TRPM1 Antibody - Azide and BSA Free

Western Blot-NBP3-04694-TRPM1 Antibody - Azide and BSA Free-analysis of SK-MEL-28, using TRPM1 antibody at 1:800 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 60s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TRPM1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit TRPM1 Antibody - Azide and BSA Free (NBP3-04694) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1460-1540 of human TRPM1 (NP_002411.3). SITDQQLTTEWQCQVQKITRSHSTDIPYIVSEAAVQAEHKEQFADMQDEHHVAEAIPRIPRLSLTITDRNGMENLLSVKPD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRPM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 182 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for TRPM1 Antibody - Azide and BSA Free

• CSNB1C
• Long transient receptor potential channel 1
• LTrpC1
• LTRPC1transient receptor potential cation channel subfamily M member 1
• melastatin 1
• melastatin-1
• MLSN
• MLSN1transient receptor potential melastatin family
• transient receptor potential cation channel, subfamily M, member 1

Background

TRPM1 is encoded by this gene is similar to the transient receptor potential (TRP) calcium channel family members. The expression of this protein is inversely correlated with melanoma aggressiveness, suggesting that it suppresses melanoma metastasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRPM1