Recombinant Human TRPA1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human TRPA1 Protein [H00008989-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human TRPA1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1033-1117 of Human TRPA1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
TRPA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
35.09 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRPA1 GST (N-Term) Protein

  • ANKTM1
  • ANKTM1ankyrin-like with transmembrane domains 1
  • Ankyrin-like with transmembrane domains protein 1
  • Transformation-sensitive protein p120
  • transient receptor potential cation channel subfamily A member 1
  • transient receptor potential cation channel, subfamily A, member 1
  • TRPA1
  • Wasabi receptor

Background

Transient receptor potential ion channels (TRPCs) are a superfamily of six transmembrane segment-spanning, gated cation channels. TRPA1 is a TRP-related channel that responds to cold temperatures and pungent compounds and plays a role in both nociceptor and hair cell transduction. It is a transformation-associated gene product in lung epithelia, whereas its protein distribution is primarily restricted to sensory neurons. Blocking TRPA1 may be a therapeutic target for treating cold hyperalgesia caused by inflammation and nerve damage. It is now known that TRPA1 protein is also widely expressed outside of the CNS and is dys-regulated during oncogenic transformation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97417
Species: Hu, In, Mu, Pm, Rt
Applications: ICC/IF, IF, IHC (-), WB
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-97311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB110-74960
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-12909
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NBP1-92576
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-45570
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF6457
Species: Hu
Applications: WB
NBP1-89342
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-01679
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
AF1396
Species: Hu
Applications: WB
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NBP2-33806
Species: Hu
Applications: IHC,  IHC-P, WB
H00008989-Q01
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for TRPA1 Partial Recombinant Protein (H00008989-Q01) (0)

There are no publications for TRPA1 Partial Recombinant Protein (H00008989-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRPA1 Partial Recombinant Protein (H00008989-Q01) (0)

There are no reviews for TRPA1 Partial Recombinant Protein (H00008989-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRPA1 Partial Recombinant Protein (H00008989-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRPA1 Products

Research Areas for TRPA1 Partial Recombinant Protein (H00008989-Q01)

Find related products by research area.

Blogs on TRPA1.

Winter is coming, and TRPM8 welcomes the cold!
TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds.  While TRPM8 is best known for its location in peripheral nerve endings, it has functio...  Read full blog post.

TRPA1: A contributor to itching and inflammation? Scratch that!
Transient receptor potential A1 (TRPA1) is an ion channel found on the plasma membrane of many cell types that functions in diverse sensory processes such as pain and temperature. The TRPA1 ion channel is specifically expressed in nociceptive neurons,...  Read full blog post.

Touch Infographic: From Touch Receptors to the Brain
The body contains thousands of receptors and nerves which allow us to experience the sense of touch, also referred to as tactile perception. The somatosensory system allows organisms to perceive and decode a wide range of tactile stimuli to allow for ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TRPA1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPA1