Recombinant Human TRP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TRP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 442-505 of Human TRPC1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AHNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TRPC1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRP1 Protein

  • HTRP-1
  • MGC133334
  • MGC133335
  • transient receptor potential canonical 1
  • transient receptor potential cation channel, subfamily C, member 1
  • transient receptor potential channel 1
  • Transient receptor protein 1
  • TRP-1
  • TRP1short transient receptor potential channel 1
  • TrpC1

Background

TRPC1 - transient receptor potential cation channel, subfamily C, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-70352
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IF
NBP1-00142
Species: Hu, Mu
Applications: WB, IP, PEP-ELISA
NBP2-12905
Species: Rt
Applications: WB, ICC/IF, IHC, IP
NBP2-12919
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
H00006786-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NBP1-75522
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-81601
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-30151
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-58719
Species: Hu
Applications: WB, ICC/IF
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008847-P01
Species: Hu
H00007220-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TRP1 Partial Recombinant Protein (H00007220-Q01) (0)

There are no publications for TRP1 Partial Recombinant Protein (H00007220-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRP1 Partial Recombinant Protein (H00007220-Q01) (0)

There are no reviews for TRP1 Partial Recombinant Protein (H00007220-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRP1 Partial Recombinant Protein (H00007220-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRP1 Products

Bioinformatics Tool for TRP1 Partial Recombinant Protein (H00007220-Q01)

Discover related pathways, diseases and genes to TRP1 Partial Recombinant Protein (H00007220-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRP1 Partial Recombinant Protein (H00007220-Q01)

Discover more about diseases related to TRP1 Partial Recombinant Protein (H00007220-Q01).
 

Pathways for TRP1 Partial Recombinant Protein (H00007220-Q01)

View related products by pathway.

PTMs for TRP1 Partial Recombinant Protein (H00007220-Q01)

Learn more about PTMs related to TRP1 Partial Recombinant Protein (H00007220-Q01).

Blogs on TRP1

There are no specific blogs for TRP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TRP1 Antibody
NB100-98844
STIM1 Antibody (5A2)
H00006786-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TRP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPC1