TROVE2 Antibody

Images

 
Western Blot: TROVE2 Antibody [NBP2-55127] - Analysis in human cell line K562 and human cell line PC-3.
Immunocytochemistry/ Immunofluorescence: TROVE2 Antibody [NBP2-55127] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TROVE2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGF
Specificity
Specificity of human TROVE2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TROVE2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Mouse 87%, Rat 86%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TROVE2 Antibody

  • 60 kDa ribonucleoprotein Ro
  • 60 kDa Ro protein
  • 60 kDa SS-A/Ro ribonucleoprotein
  • Ro 60 kDa autoantigen
  • RO60gastric cancer multi-drug resistance protein
  • RORNP
  • Sjoegren syndrome antigen A2
  • Sjoegren syndrome type A antigen
  • Sjogren syndrome antigen A2 (60kDa, ribonucleoprotein autoantigen SS-A/Ro)
  • SS-A
  • SSA2Sjogren syndrome antigen A2 (60kD, ribonucleoprotein autoantigen SS-A/Ro)
  • TROVE domain family member 2
  • TROVE domain family, member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, PA, B/N, KD
NBP1-87122
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33549
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57138
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Rb, Ye
Applications: WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57487
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
H00003347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55127
Species: Hu
Applications: WB, ICC/IF

Publications for TROVE2 Antibody (NBP2-55127) (0)

There are no publications for TROVE2 Antibody (NBP2-55127).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TROVE2 Antibody (NBP2-55127) (0)

There are no reviews for TROVE2 Antibody (NBP2-55127). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TROVE2 Antibody (NBP2-55127) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TROVE2 Products

Bioinformatics Tool for TROVE2 Antibody (NBP2-55127)

Discover related pathways, diseases and genes to TROVE2 Antibody (NBP2-55127). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TROVE2 Antibody (NBP2-55127)

Discover more about diseases related to TROVE2 Antibody (NBP2-55127).
 

Pathways for TROVE2 Antibody (NBP2-55127)

View related products by pathway.

PTMs for TROVE2 Antibody (NBP2-55127)

Learn more about PTMs related to TROVE2 Antibody (NBP2-55127).

Blogs on TROVE2

There are no specific blogs for TROVE2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TROVE2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TROVE2