Tropomyosin-1 Antibody

Images

 
Western Blot: Tropomyosin-1 Antibody [NBP1-89896] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunocytochemistry/ Immunofluorescence: Tropomyosin-1 Antibody [NBP1-89896] - Staining of human cell line U-2 OS shows positivity in cytoplasm and cytoskeleton (actin filaments).
Immunohistochemistry-Paraffin: Tropomyosin-1 Antibody [NBP1-89896] - Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Tropomyosin-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGQVRQLEEQLRIMDQTLKALMAAEDKYSQKEDRYEEEIKVLSDKLKEAETRAEFAE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TPM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Tropomyosin-1 Protein (NBP1-89896PEP)
Publications
Read Publication using NBP1-89896.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tropomyosin-1 Antibody

  • alpha tropomyosin
  • alpha-tropomyosin
  • C15orf13
  • cardiomyopathy, hypertrophic 3
  • chromosome 15 open reading frame 13
  • CMD1Y
  • CMH3
  • HTM-alpha
  • sarcomeric tropomyosin kappa
  • TMSA
  • tropomyosin 1 (alpha) isoform 1
  • tropomyosin 1 (alpha) isoform 2
  • tropomyosin 1 (alpha) isoform 3
  • tropomyosin 1 (alpha) isoform 4
  • tropomyosin 1 (alpha) isoform 5
  • tropomyosin 1 (alpha) isoform 6
  • tropomyosin 1 (alpha) isoform 7
  • tropomyosin 1 (alpha)
  • tropomyosin alpha-1 chain
  • tropomyosin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52737
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87382
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB110-2546
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Fi, Gt, Rb
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NB200-412
Species: Hu, Mu, Rt, Ca
Applications: IA, S-ELISA
AF7439
Species: Hu
Applications: WB, IHC
NBP1-32770
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56146
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00007134-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-1908
Species: Hu, Mu, Rt, Po, Bv, Ch, Rb
Applications: WB, ELISA, ICC/IF, IHC, IP, MiAr
NBP1-33759
Species: Mu
Applications: WB, IHC, IHC-P
NB120-11099
Species: Hu, Mu, Rt, Po, Al, Am, Av, Bv, Ch, Fi, Rb
Applications: WB, ICC/IF
NBP1-30249
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
NBP1-88068
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP

Publications for Tropomyosin-1 Antibody (NBP1-89896)(1)

Reviews for Tropomyosin-1 Antibody (NBP1-89896) (0)

There are no reviews for Tropomyosin-1 Antibody (NBP1-89896). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Tropomyosin-1 Antibody (NBP1-89896). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for a mouse anti human TPM1 antibody, and am interested in NB100-1908. However, I specifically need one with cross reactivity against all TPM1 isoforms. Could you tell me what epitope your antibody recognizes, or failing that (I realize this is often confidential), which exon of the gene the epitope is situated in? I could not find this information on the datasheet, and therefore cannot tell whether your antibody would suit the application I have in mind.
    • In regards to your inquiry, unfortunately NB100-1908 has not been epitope mapped so we are unaware of the location or exon that the epitope is situated in. I am not sure what application and species you were looking for an antibody against, but this TPM1 antibody (NBP1-89896) for example has the immunogen sequence listed for you and might be helpful since you will have access to this information.

Secondary Antibodies

 

Isotype Controls

Additional Tropomyosin-1 Products

Bioinformatics Tool for Tropomyosin-1 Antibody (NBP1-89896)

Discover related pathways, diseases and genes to Tropomyosin-1 Antibody (NBP1-89896). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tropomyosin-1 Antibody (NBP1-89896)

Discover more about diseases related to Tropomyosin-1 Antibody (NBP1-89896).
 

Pathways for Tropomyosin-1 Antibody (NBP1-89896)

View related products by pathway.

PTMs for Tropomyosin-1 Antibody (NBP1-89896)

Learn more about PTMs related to Tropomyosin-1 Antibody (NBP1-89896).
 

Research Areas for Tropomyosin-1 Antibody (NBP1-89896)

Find related products by research area.

Blogs on Tropomyosin-1

There are no specific blogs for Tropomyosin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tropomyosin-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TPM1