TRMU Antibody

Images

 
Immunohistochemistry: TRMT1 Antibody [NBP1-87923] - Staining of human skeletal muscle shows strong cytoplasmic positivity.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRMU Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRMU
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TRMU Recombinant Protein Antigen (NBP1-87923PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRMU Antibody

  • EC 2.8.1
  • EC 2.8.1.-
  • FLJ10140
  • mitochondrial 5-methylaminomethyl-2-thiouridylate-methyltransferase
  • mitochondrial tRNA-specific 2-thiouridylase 1
  • MTO2 homolog
  • MTO2MGC99627
  • MTU1
  • TRMT
  • TRMT1
  • tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
  • tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase
  • TRNT1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85932
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-79340
Species: Hu
Applications: WB
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-91974
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1800
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P, IP
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP1-91810
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-45795
Species: Hu
Applications: WB, IHC
NBP1-86889
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46161
Species: Hu
Applications: WB, IHC
AF-253-NA
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
MAB7447
Species: Hu
Applications: WB, IHC
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-86851
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20030
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
640-A3
Species: Mu
NBP2-20928
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87923
Species: Hu, Rt
Applications: IHC, IHC-P

Publications for TRMU Antibody (NBP1-87923) (0)

There are no publications for TRMU Antibody (NBP1-87923).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRMU Antibody (NBP1-87923) (0)

There are no reviews for TRMU Antibody (NBP1-87923). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TRMU Antibody (NBP1-87923) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRMU Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRMU