MTO1 Antibody

Images

 
Western Blot: MTO1 Antibody [NBP1-54767] - Detection of MTO1 in HeLa whole cell lysate enriched for mitochondria via digitonin treatment prior to cell pelleting (Hm lane) and human fibroblast whole cell lysate (Fi ...read more
Western Blot: MTO1 Antibody [NBP1-54767] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MTO1 Antibody Summary

Immunogen
Synthetic peptides corresponding to MTO1(mitochondrial translation optimization 1 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of MTO1 (NP_001116698). Peptide sequence STVYAESVILTTGTFLRGMIVIGLETHPAGRLGDQPSIGLAQTLEKLGFV. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (93%), Rat (100%), Porcine (100%), Bovine (92%), Guinea Pig (93%), Rabbit (93%), Canine (93%), Equine (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MTO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against MTO1 and was validated on Western blot.
Theoretical MW
81 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 4
using
NBP1-54767 in the following application:

Publications
Read Publication using NBP1-54767.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MTO1 Antibody

  • EC 1.1.1.40
  • EC 6.3.5
  • homolog of yeast Mto1
  • mitochondrial MTO1-3
  • mitochondrial translation optimization 1 homolog (S. cerevisiae)
  • protein MTO1 homolog, mitochondrial

Background

MTO1 is a mitochondrial protein thought to be involved in mitochondrial tRNA modification. It may also play a role in the expression of the non-syndromic and aminoglycoside-induced deafness phenotypes associated with a specific mutation in the mitochondrial 12S rRNA gene.This gene encodes a mitochondrial protein thought to be involved in mitochondrial tRNA modification. The encoded protein may also play a role in the expression of the non-syndromic and aminoglycoside-induced deafness phenotypes associated with a specific mutation in the mitochondrial 12S rRNA gene. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46016
Species: Hu, Mu, Ca, Pm
Applications: WB, IF
NBP1-85500
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-91974
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-57840
Species: Hu, Mu, Rt
Applications: WB, Flow, PEP-ELISA
NBP1-84621
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00728695-B01P
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-44743
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
H00027349-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-94912
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB4470
Species: All-Multi
Applications: WB, IHC, ICC
H00002707-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-67699
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-81948
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for MTO1 Antibody (NBP1-54767)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-54767 Applications Species
Krull,M. Mol. Biol. Evol. 22 (8), 1702-1711. 2005 [PMID: 15901843]

Review for MTO1 Antibody (NBP1-54767) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-54767:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot MTO1 NBP1-54767
Enlarge
4
reviewed by:
Anonymous
WB Human 08/23/2013
View

Summary

ApplicationWestern Blot
Sample TestedHeLA whole cell lysate and lysate enriched for mitochondria by digitonin treatment; human fibroblast whole cell lysate
SpeciesHuman
LotQC23680
CommentsIn fibroblasts a sharp, specific band was detected at approximately 77 kDa (when comparing to image, please note that the molecular weight marker consistently has a 5 kDa offset in this system), with an additional weaker band just above it. In HeLa cells enriched for mitochondria (digitonin treatment prior to cell pelleting), the same strong 77 kDa band was also detected, with an additional weaker band at approximately 72 kDa. The identity of the 77 kDa band was verified by using MTO1 overexpression lysate (NBL1-13381).

Blocking

Blocking Details5% milk in TBS with 0.02% Tween; 1h at room temp OR overnight at 4C

Primary Anitbody

Dilution Ratio1:2000 dilution in buffer (1X TBS, 0.1% NaN3, 0.1% BSA) for 1h at room temp OR overnight at 4C

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP-conjugated
Secondary Manufacturer Cat#Bio-Rad 172-1019
Secondary Concentration1:30,000

Details

Detection NotesECL using Super signal west femto (Thermo Scientific), ChemiDoc imager and ImageLab software (Bio-Rad)

Comments

CommentsIn fibroblasts a sharp, specific band was detected at approximately 77 kDa (when comparing to image, please note that the molecular weight marker consistently has a 5 kDa offset in this system), with an additional weaker band just above it. In HeLa cells enriched for mitochondria (digitonin treatment prior to cell pelleting), the same strong 77 kDa band was also detected, with an additional weaker band at approximately 72 kDa. The identity of the 77 kDa band was verified by using MTO1 overexpression lysate (NBL1-13381).

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTO1 Antibody (NBP1-54767) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
08/23/2013
Application: WB
Species: Human

Bioinformatics

Gene Symbol MTO1
Entrez
Uniprot