Reactivity | HuSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | Synthetic peptides corresponding to MTO1(mitochondrial translation optimization 1 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of MTO1 (NP_001116698).
Peptide sequence STVYAESVILTTGTFLRGMIVIGLETHPAGRLGDQPSIGLAQTLEKLGFV. The peptide sequence for this immunogen was taken from within the described region. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | MTO1 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | This is a rabbit polyclonal antibody against MTO1 and was validated on Western blot. |
|
Theoretical MW | 81 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
Reviewed Applications |
|
|
Publications |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS and 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-54767 | Applications | Species |
---|---|---|
Krull,M. Mol. Biol. Evol. 22 (8), 1702-1711. 2005 [PMID: 15901843] |
Images | Ratings | Applications | Species | Date | Details | ||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() Enlarge |
reviewed by:
Maria Holmström |
Western Blot | Human | 08/23/2013 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for MTO1 Antibody (NBP1-54767)Discover more about diseases related to MTO1 Antibody (NBP1-54767).
| Pathways for MTO1 Antibody (NBP1-54767)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
Maria Holmström 08/23/2013 |
||
Application: | Western Blot | |
Species: | Human |