MTO1 Antibody

Western Blot: MTO1 Antibody [NBP1-54767] - Detection of MTO1 in HeLa whole cell lysate enriched for mitochondria via digitonin treatment prior to cell pelleting (Hm lane) and human fibroblast whole cell lysate (Fi lane). Image provided by Maria Holmstrom of Gothenburg University.

Western Blot: MTO1 Antibody [NBP1-54767] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Concentration: 0.5 mg/ml

MTO1 Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to MTO1(mitochondrial translation optimization 1 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of MTO1 (NP_001116698). Peptide sequence STVYAESVILTTGTFLRGMIVIGLETHPAGRLGDQPSIGLAQTLEKLGFV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MTO1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 81 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MTO1 Antibody

• EC 1.1.1.40
• EC 6.3.5
• homolog of yeast Mto1
• mitochondrial MTO1-3
• mitochondrial translation optimization 1 homolog (S. cerevisiae)
• protein MTO1 homolog, mitochondrial

Background

MTO1 is a mitochondrial protein thought to be involved in mitochondrial tRNA modification. It may also play a role in the expression of the non-syndromic and aminoglycoside-induced deafness phenotypes associated with a specific mutation in the mitochondrial 12S rRNA gene.This gene encodes a mitochondrial protein thought to be involved in mitochondrial tRNA modification. The encoded protein may also play a role in the expression of the non-syndromic and aminoglycoside-induced deafness phenotypes associated with a specific mutation in the mitochondrial 12S rRNA gene. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MTO1 Antibody (NBP1-54767)(1)

Publication using NBP1-54767

• Krull,M. Mol. Biol. Evol. 22 (8), 1702-1711. 2005-01-01 [PMID: 15901843]

Review for MTO1 Antibody (NBP1-54767) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Maria Holmström WB Human 08/23/2013

Summary

• Application: Western Blot
• Sample Tested: HeLA whole cell lysate and lysate enriched for mitochondria by digitonin treatment; human fibroblast whole cell lysate
• Species: Human
• Lot: QC23680

Bioinformatics

• Gene Symbol: MTO1
• Entrez:
  • 25821(Human)
• Uniprot:
  • Q9Y2Z2(Human)