MTO1 Antibody


Western Blot: MTO1 Antibody [NBP1-54767] - Detection of MTO1 in HeLa whole cell lysate enriched for mitochondria via digitonin treatment prior to cell pelleting (Hm lane) and human fibroblast whole cell lysate (Fi more
Western Blot: MTO1 Antibody [NBP1-54767] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

MTO1 Antibody Summary

Synthetic peptides corresponding to MTO1(mitochondrial translation optimization 1 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of MTO1 (NP_001116698). Peptide sequence STVYAESVILTTGTFLRGMIVIGLETHPAGRLGDQPSIGLAQTLEKLGFV. The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against MTO1 and was validated on Western blot.
Theoretical MW
81 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 4
NBP1-54767 in the following application:

Read Publication using NBP1-54767.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MTO1 Antibody

  • EC
  • EC 6.3.5
  • homolog of yeast Mto1
  • mitochondrial MTO1-3
  • mitochondrial translation optimization 1 homolog (S. cerevisiae)
  • protein MTO1 homolog, mitochondrial


MTO1 is a mitochondrial protein thought to be involved in mitochondrial tRNA modification. It may also play a role in the expression of the non-syndromic and aminoglycoside-induced deafness phenotypes associated with a specific mutation in the mitochondrial 12S rRNA gene.This gene encodes a mitochondrial protein thought to be involved in mitochondrial tRNA modification. The encoded protein may also play a role in the expression of the non-syndromic and aminoglycoside-induced deafness phenotypes associated with a specific mutation in the mitochondrial 12S rRNA gene. Multiple transcript variants encoding different isoforms have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: Flow, WB
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: WB
Species: All-Multi
Applications: ICC, IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB

Publications for MTO1 Antibody (NBP1-54767)(1)

Showing Publication 1 - 1 of 1.
Publication using NBP1-54767 Applications Species
Krull,M. Mol. Biol. Evol. 22 (8), 1702-1711. 2005 [PMID: 15901843]

Review for MTO1 Antibody (NBP1-54767) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-54767:
Filter by Applications
Western Blot
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot MTO1 NBP1-54767
reviewed by:
Maria Holmström
Western Blot Human 08/23/2013


ApplicationWestern Blot
Sample TestedHeLA whole cell lysate and lysate enriched for mitochondria by digitonin treatment; human fibroblast whole cell lysate

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTO1 Antibody (NBP1-54767) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Maria Holmström
Application: Western Blot
Species: Human


Gene Symbol MTO1