![Western Blot: Proteasome 19S S7 Antibody [NBP1-87797] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize2/Proteasome 19S S7 Antibody-Western Blot-NBP1-87797-img0008.jpg "Western Blot: Proteasome 19S S7 Antibody [NBP1-87797] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAA |
| Specificity | Specificity of human, mouse, rat Proteasome 19S S7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PSMC2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Anonymous |
WB | Human | 08/20/2015 |
Summary
Blocking
Primary Anitbody
Secondary Antibody
Details
|
Secondary Antibodies |
Isotype Controls |
Diseases for Proteasome 19S S7 Antibody (NBP1-87797)Discover more about diseases related to Proteasome 19S S7 Antibody (NBP1-87797).
| Pathways for Proteasome 19S S7 Antibody (NBP1-87797)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PSMC2 |
![Immunohistochemistry-Paraffin: Proteasome 19S S7 Antibody [NBP1-87797] - Staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in neuronal cells.](http://images.novusbio.com/fullsize2/Proteasome-19S-S7-Antibody-Immunohistochemistry-Paraffin-NBP1-87797-img0001.jpg "Immunohistochemistry-Paraffin: Proteasome 19S S7 Antibody [NBP1-87797] - Staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in neuronal cells.")
![Western Blot: Proteasome 19S S7 Antibody [NBP1-87797] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize2/Proteasome-19S-S7-Antibody-Western-Blot-NBP1-87797-img0006.jpg "Western Blot: Proteasome 19S S7 Antibody [NBP1-87797] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Western Blot: PSMC1 Antibody [NBP1-80959] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.](http://images.novusbio.com/fullsize2/PSMC1 Antibody-Western Blot-NBP1-80959-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: PSMC1 Antibody [NBP1-80959] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.](http://images.novusbio.com/fullsize2/PSMC1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80959-img0008.jpg)
![Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize2/PSMC1-Antibody-Immunohistochemistry-Paraffin-NBP1-80959-img0012.jpg)
![Immunohistochemistry-Paraffin: RPS4X Antibody [NBP1-82761] - RPS4Y1 Antibody [NBP1-82761] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/RPS4X-Antibody-Immunohistochemistry-Paraffin-NBP1-82761-img0004.jpg)
![Western Blot: SUG1 Antibody (25D5) [NB100-345] - SUG1 antibody with 30 ug whole cell lysate run on SDS-PAGE. Lane A: 293T; B: A431; C: H1299; D: Hela; E: Hep G2; F: Molt-4; G: Raji 10% SDS PAGE diluted at 1:1000](http://images.novusbio.com/fullsize2/SUG1-Antibody-(25D5)-Western-Blot-NB100-345-img0002.jpg)
![Western Blot: RPS12 Antibody [NBP2-58885] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.](http://images.novusbio.com/fullsize2/RPS12 Antibody-Western Blot-NBP2-58885-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: RPS12 Antibody [NBP2-58885] - Staining of human cell line U-251 MG shows localization to cytosol.](http://images.novusbio.com/fullsize2/RPS12-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-58885-img0001.jpg)
![Western Blot: RPS3 Antibody [NBP1-33691] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with RPS3 antibody diluted at a dilution of 1:500.](http://images.novusbio.com/fullsize2/RPS3-Antibody-Western-Blot-NBP1-33691-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: RPS3 Antibody [NBP1-33691] - Analysis of methanol-fixed HeLa, using RPS3 antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled with an alpha Tubulin antibody (Red) at 1:2000.](http://images.novusbio.com/fullsize2/RPS3 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-33691-img0003.jpg)
![Immunohistochemistry-Paraffin: RPS3 Antibody [NBP1-33691] - Paraffin-embedded mouse intestine diluted at 1:500.](http://images.novusbio.com/fullsize2/RPS3-Antibody-Immunohistochemistry-Paraffin-NBP1-33691-img0009.jpg)
![Western Blot: Proteasome 19S S3 Antibody (2A2) [NBP2-01808] Analysis of extracts (35ug) from 9 different cell lines by using anti-Proteasome 19S S3 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).](http://images.novusbio.com/fullsize/Proteasome 19S S3 Antibody (2A2)-Western Blot-NBP2-01808-img0005.jpg)
![Flow Cytometry: Proteasome 19S S3 Antibody (2A2) [NBP2-01808] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Proteasome 19S S3 antibody, and then analyzed by flow cytometry.](http://images.novusbio.com/fullsize/Proteasome 19S S3 Antibody (2A2)-Flow Cytometry-NBP2-01808-img0003.jpg)
![Western Blot: Proteasome 19S S3 Antibody (2A2) [NBP2-01808] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Proteasome 19S S3 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Proteasome 19S S3.](http://images.novusbio.com/fullsize/Proteasome 19S S3 Antibody (2A2)-Western Blot-NBP2-01808-img0004.jpg)
![Western Blot: RPS9 Antibody [NBP2-22298] - Whole cell lysate from HeLa (15 and 50 ug), 293T (50 ug), Jurkat (50 ug), and mouse NIH3T3 (50 ug) cells. NBP2-22298 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.](http://images.novusbio.com/fullsize2/RPS9-Antibody-Western-Blot-NBP2-22298-img0001.jpg)
![Immunohistochemistry: RPS9 Antibody [NBP2-22298] - Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti- RPS9 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB. Counterstain: Hematoxylin (blue).](http://images.novusbio.com/fullsize2/RPS9-Antibody-Immunohistochemistry-NBP2-22298-img0006.jpg)
![Western Blot: Tbp7 Antibody [NBP1-87799] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.](http://images.novusbio.com/fullsize2/Tbp7 Antibody-Western Blot-NBP1-87799-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: Tbp7 Antibody [NBP1-87799] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.](http://images.novusbio.com/fullsize2/Tbp7-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87799-img0009.jpg)
![Immunohistochemistry-Paraffin: Tbp7 Antibody [NBP1-87799] - Staining of human gall bladder shows nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize2/Tbp7-Antibody-Immunohistochemistry-Paraffin-NBP1-87799-img0001.jpg)
![Western Blot: PSMD11 Antibody [NBP1-46191] - Whole cell lysate from HeLa (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 mcg), and mouse NIH3T3 (M; 50 mcg) cells. Affinity purified rabbit anti-PSMD11 antibody used for WB at 0.04 mcg/ml (A) and 0.4 mcg/ml (B) and used for IP at 3 mcg/mg lysate. PSMD11 was also immunoprecipitated by rabbit anti-PSMD11 antibody NBP1-46192, which recognizes a downstream epitope.](http://images.novusbio.com/fullsize2/PSMD11-Antibody-Western-Blot-NBP1-46191-img0002.jpg)
![Western Blot: Ribosomal Protein S6/RPS6 Antibody [NB100-1595] - Detection of Human RPS6 on HeLa whole cell lysate using NB100-1595. RPS6 was also immunoprecipitated using rabbit anti-RPS6 antibodies NB100-1594 and another RPS6 Ab.](http://images.novusbio.com/fullsize2/Ribosomal-Protein-S6-RPS6-Antibody-Western-Blot-NB100-1595-img0001.jpg)
![Immunohistochemistry: Ribosomal Protein S6/RPS6 Antibody [NB100-1595] - Sample: FFPE section of human lung carcinoma. Antibody: Affinity purified rabbit anti- RPS6 used at a dilution of 1:200 (1ug/ml). Detection: DAB](http://images.novusbio.com/fullsize2/Ribosomal Protein S6-RPS6 Antibody-Immunohistochemistry-NB100-1595-img0006.jpg)
![Western Blot: PSMD7 Antibody [NBP2-38612] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize2/PSMD7-Antibody-Western-Blot-NBP2-38612-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: PSMD7 Antibody [NBP2-38612] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm.](http://images.novusbio.com/fullsize2/PSMD7 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38612-img0004.jpg)
![Immunohistochemistry: PSMD7 Antibody [NBP2-38612] - Staining of human hippocampus shows strong nuclear positivity in neuronal cells.](http://images.novusbio.com/fullsize2/PSMD7-Antibody-Immunohistochemistry-NBP2-38612-img0002.jpg)
![Western Blot: 5-HT1B Antibody [NB100-56350] - Analysis of 5-HT1B in human brain lysate with anti-5-HT1BR pcAb (NB100-56350). A protein band of approximate molecular weight of 40-41kDa was detected.](http://images.novusbio.com/fullsize2/5-HT1B-Antibody-Western-Blot-NB100-56350-img0004.jpg)
![Western Blot: RPS10 Antibody [NBP1-31357] - Sample (30 ug of whole cell lysate) A: A431 12% SDS PAGE; antibody diluted at 1:1000.](http://images.novusbio.com/fullsize2/RPS10 Antibody-Western Blot-NBP1-31357-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: RPS10 Antibody [NBP1-31357] - Analysis of HeLa, using NBP1-31357 at 1:200 dilution.](http://images.novusbio.com/fullsize2/RPS10 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-31357-img0003.jpg)
![Immunohistochemistry-Paraffin: RPS10 Antibody [NBP1-31357] - Paraffin-embedded mouse colon diluted at 1:500.](http://images.novusbio.com/fullsize2/RPS10-Antibody-Immunohistochemistry-Paraffin-NBP1-31357-img0008.jpg)
![Western Blot: PSMD6 Antibody [NBP1-81545] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize2/PSMD6-Antibody-Western-Blot-NBP1-81545-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: PSMD6 Antibody [NBP1-81545] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles.](http://images.novusbio.com/fullsize2/PSMD6 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81545-img0007.jpg)
![Immunohistochemistry-Paraffin: PSMD6 Antibody [NBP1-81545] - Staining of human hippocampus shows strong nuclear positivity in neuronal cells.](http://images.novusbio.com/fullsize2/PSMD6-Antibody-Immunohistochemistry-Paraffin-NBP1-81545-img0002.jpg)
![Western Blot: L1CAM Antibody (2A6) [NBP2-02149] Analysis of extracts (35ug) from 9 different cell lines by using anti-L1CAM monoclonal antibody.](http://images.novusbio.com/fullsize/L1CAM Antibody (2A6)-Western Blot-NBP2-02149-img0012.jpg)
![Immunocytochemistry/Immunofluorescence: L1CAM Antibody (2A6) [NBP2-02149] - Staining of COS7 cells.](http://images.novusbio.com/fullsize2/L1CAM-Antibody-(2A6)-Immunocytochemistry-Immunofluorescence-NBP2-02149-img0015.jpg)
![Immunohistochemistry-Paraffin: L1CAM Antibody (2A6) [NBP2-02149] - Staining of paraffin-embedded pancreas tissue using anti-L1CAMmouse monoclonal antibody.](http://images.novusbio.com/fullsize/L1CAM Antibody (2A6)-Immunohistochemistry-Paraffin-NBP2-02149-img0010.jpg)
![Western Blot: RPS5 Antibody (4H3) [H00006193-M02] - RPS5 monoclonal antibody (M02), clone 4H3. Analysis of RPS5 expression in NIH/3T3.](http://images.novusbio.com/fullsize2/RPS5-Antibody-(4H3)-Western-Blot-H00006193-M02-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: RPS5 Antibody (4H3) [H00006193-M02] - Analysis of monoclonal antibody to RPS5 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize2/RPS5-Antibody-(4H3)-Immunocytochemistry-Immunofluorescence-H00006193-M02-img0008.jpg)
![Western Blot: RPS5 Antibody (4H3) [H00006193-M02] - RPS5 monoclonal antibody (M02), clone 4H3 Analysis of RPS5 expression in HeLa.](http://images.novusbio.com/fullsize2/RPS5-Antibody-(4H3)-Western-Blot-H00006193-M02-img0010.jpg)
![Western Blot: Rpn2 Antibody [NB120-2941] - Analysis of proteasome 19S subunit S1 from HeLa cell extract.](http://images.novusbio.com/fullsize2/Rpn2 Antibody-Western Blot-NB120-2941-img0003.jpg)
![Western Blot: PSMD8 Antibody [NBP1-83254] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize2/PSMD8-Antibody-Western-Blot-NBP1-83254-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: PSMD8 Antibody [NBP1-83254] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.](http://images.novusbio.com/fullsize2/PSMD8-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83254-img0006.jpg)
![Immunohistochemistry-Paraffin: PSMD8 Antibody [NBP1-83254] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize2/PSMD8-Antibody-Immunohistochemistry-Paraffin-NBP1-83254-img0008.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0005.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.")