Proteasome 19S S7 Antibody


Western Blot: Proteasome 19S S7 Antibody [NBP1-87797] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Proteasome 19S S7 Antibody [NBP1-87797] - Staining of human hippocampus shows strong nuclear positivity in neuronal cells.
Simple Western: Proteasome 19S S7 Antibody [NBP1-87797] - Mouse whole spleen lysates at the indicated concentrations were probed with a 1:25 dilution of this Proteasome 19S S7 antibody. Burn-out of the major peak is more

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P

Order Details

Proteasome 19S S7 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAA
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Simple Western
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Proteasome 19S S7 antibody validated for Simple Western from a verified customer review.
Control Peptide
Proteasome 19S S7 Protein (NBP1-87797PEP)
Reviewed Applications
Read 2 Reviews rated 4.5
NBP1-87797 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Proteasome 19S S7 Antibody

  • 26S protease regulatory subunit 7
  • 26S proteasome AAA-ATPase subunit RPT1
  • MGC3004
  • MSS1ATPase, 2
  • proteasome (prosome, macropain) 26S subunit, ATPase, 2
  • Protein MSS1
  • putative protein product of Nbla10058


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ChIP, IP, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Dr, Hu, Mu
Applications: IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Pr, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Proteasome 19S S7 Antibody (NBP1-87797) (0)

There are no publications for Proteasome 19S S7 Antibody (NBP1-87797).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome 19S S7 Antibody (NBP1-87797) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 2 species: Human, Mouse.

Reviews using NBP1-87797:
Filter by Applications
Simple Western
Western Blot
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Simple Western Proteasome 19S S7 NBP1-87797
reviewed by:
Julian Wong
Simple Western Mouse 08/23/2019


ApplicationSimple Western
Sample TestedMouse Spleen Lysate
reviewed by:
Grace zhou
Western Blot Human 08/20/2015


ApplicationWestern Blot
Sample TestedHEK 293 cell lysate20 ug

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proteasome 19S S7 Antibody (NBP1-87797) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Proteasome 19S S7 Products

Bioinformatics Tool for Proteasome 19S S7 Antibody (NBP1-87797)

Discover related pathways, diseases and genes to Proteasome 19S S7 Antibody (NBP1-87797). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteasome 19S S7 Antibody (NBP1-87797)

Discover more about diseases related to Proteasome 19S S7 Antibody (NBP1-87797).

Pathways for Proteasome 19S S7 Antibody (NBP1-87797)

View related products by pathway.

PTMs for Proteasome 19S S7 Antibody (NBP1-87797)

Learn more about PTMs related to Proteasome 19S S7 Antibody (NBP1-87797).

Research Areas for Proteasome 19S S7 Antibody (NBP1-87797)

Find related products by research area.

Blogs on Proteasome 19S S7

There are no specific blogs for Proteasome 19S S7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Julian Wong
Application: Simple Western
Species: Mouse

Grace zhou
Application: Western Blot
Species: Human


Gene Symbol PSMC2