Proteasome 19S S7 Antibody

Images

 
Western Blot: Proteasome 19S S7 Antibody [NBP1-87797] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Proteasome 19S S7 Antibody [NBP1-87797] - Staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in neuronal cells.
Western Blot: Proteasome 19S S7 Antibody [NBP1-87797] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Proteasome 19S S7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAA
Specificity
Specificity of human, mouse, rat Proteasome 19S S7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Proteasome 19S S7 Protein (NBP1-87797PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-87797 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Proteasome 19S S7 Antibody

  • 26S protease regulatory subunit 7
  • 26S proteasome AAA-ATPase subunit RPT1
  • MGC3004
  • MSS1ATPase, 2
  • proteasome (prosome, macropain) 26S subunit, ATPase, 2
  • Protein MSS1
  • putative protein product of Nbla10058

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006192-P01
Species: Hu
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NB100-345
Species: Hu
Applications: WB, ChIP, IP
NBP2-58885
Species: Hu
Applications: WB, ICC/IF
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
H00006202-Q01
Species: Hu
NBP2-22298
Species: Hu, Mu
Applications: IP (-), WB, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46191
Species: Hu, Mu
Applications: WB, IP
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81545
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP1-83254
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Proteasome 19S S7 Antibody (NBP1-87797) (0)

There are no publications for Proteasome 19S S7 Antibody (NBP1-87797).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Proteasome 19S S7 Antibody (NBP1-87797) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-87797:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Anonymous
WB Human 08/20/2015
View

Summary

ApplicationWestern Blot
Sample TestedHEK 293 cell lysate20 ug
SpeciesHuman

Blocking

Blocking Details5 % Non-fat milk for 20 minutes at RT

Primary Anitbody

Dilution Ratio1:800

Secondary Antibody

Secondary DescriptionGOAT ANTI-rabbit igG, HRP
Secondary Concentration1:10000

Details

Detection Noteschemiluminescent, GE 4000, 30sec

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proteasome 19S S7 Antibody (NBP1-87797) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Proteasome 19S S7 Products

Bioinformatics Tool for Proteasome 19S S7 Antibody (NBP1-87797)

Discover related pathways, diseases and genes to Proteasome 19S S7 Antibody (NBP1-87797). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteasome 19S S7 Antibody (NBP1-87797)

Discover more about diseases related to Proteasome 19S S7 Antibody (NBP1-87797).
 

Pathways for Proteasome 19S S7 Antibody (NBP1-87797)

View related products by pathway.

PTMs for Proteasome 19S S7 Antibody (NBP1-87797)

Learn more about PTMs related to Proteasome 19S S7 Antibody (NBP1-87797).
 

Research Areas for Proteasome 19S S7 Antibody (NBP1-87797)

Find related products by research area.

Blogs on Proteasome 19S S7

There are no specific blogs for Proteasome 19S S7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

 
Anonymous
08/20/2015
Application: WB
Species: Human

Bioinformatics

Gene Symbol PSMC2