Home » Proteasome 19S S7 » Proteasome 19S S7 Antibodies » Proteasome 19S S7 Antibody

Proteasome 19S S7 Antibody

 (2 Reviews)
 
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Proteasome 19S S7 Antibody [NBP1-87797] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Western Blot: Proteasome 19S S7 Antibody [NBP1-87797] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Proteasome 19S S7 Antibody [NBP1-87797] - Staining of human hippocampus shows strong nuclear positivity in neuronal cells.
Simple Western: Proteasome 19S S7 Antibody [NBP1-87797] - Mouse whole spleen lysates at the indicated concentrations were probed with a 1:25 dilution of this Proteasome 19S S7 antibody. Burn-out of the major peak is ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Proteasome 19S S7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAA
Specificity
Specificity of human Proteasome 19S S7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Simple Western
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Proteasome 19S S7 antibody validated for Simple Western from a verified customer review.
Control Peptide
Reviewed Applications
Read 2 Reviews rated 4.5
using
NBP1-87797 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Proteasome 19S S7 Antibody

  • 26S protease regulatory subunit 7
  • 26S proteasome AAA-ATPase subunit RPT1
  • MGC3004
  • MSS1ATPase, 2
  • proteasome (prosome, macropain) 26S subunit, ATPase, 2
  • Protein MSS1
  • putative protein product of Nbla10058

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PSMC1 Antibody
NBP1-80959
Western Blot: PSMC1 Antibody [NBP1-80959] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunocytochemistry/Immunofluorescence: PSMC1 Antibody [NBP1-80959] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Recombinant Human
RPS4Y1 Protein
H00006192-P01
SDS-Page: Recombinant Human RPS4Y1 Protein [H00006192-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
(1 Review)
Species: Hu
RPS4X Antibody
NBP1-82761
Immunohistochemistry-Paraffin: RPS4X Antibody [NBP1-82761] - RPS4Y1 Antibody [NBP1-82761] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P
SUG1 Antibody
(25D5)
NB100-345
Western Blot: SUG1 Antibody (25D5) [NB100-345] - SUG1 antibody with 30 ug whole cell lysate run on SDS-PAGE. Lane A: 293T; B: A431; C: H1299; D: Hela; E: Hep G2; F: Molt-4; G: Raji 10% SDS PAGE diluted at 1:1000
(2 Reviews)
(4 Publications)
Species: Hu
Applications: WB, ChIP, IP
RPS12 Antibody
NBP2-58885
Western Blot: RPS12 Antibody [NBP2-58885] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/Immunofluorescence: RPS12 Antibody [NBP2-58885] - Staining of human cell line U-251 MG shows localization to cytosol.
Western Blot: RPS12 Antibody [NBP2-58885] - Analysis in human cell line HL-60.
Species: Hu
Applications: WB, ICC/IF
RPS3 Antibody
NBP1-33691
Western Blot: RPS3 Antibody [NBP1-33691] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with RPS3 antibody diluted at a dilution of 1:500.
Immunocytochemistry/Immunofluorescence: RPS3 Antibody [NBP1-33691] - Analysis of methanol-fixed HeLa, using RPS3 antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled with an alpha Tubulin antibody (Red) at 1:2000.
Immunohistochemistry-Paraffin: RPS3 Antibody [NBP1-33691] - Mouse intestine diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Proteasome 19S S3
Antibody (OTI2A2)
NBP2-01808
Western Blot: Proteasome 19S S3 Antibody (2A2) [NBP2-01808] Analysis of extracts (35ug) from 9 different cell lines by using anti-Proteasome 19S S3 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Flow Cytometry: Proteasome 19S S3 Antibody (2A2) [NBP2-01808] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Proteasome 19S S3 antibody, and then analyzed by flow cytometry.
Western Blot: Proteasome 19S S3 Antibody (2A2) [NBP2-01808] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Proteasome 19S S3 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Proteasome 19S S3.
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
Recombinant Human
RPS8 Protein
H00006202-Q01
SDS-Page: Recombinant Human RPS8 Protein [H00006202-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
RPS9 Antibody
NBP2-22298
Western Blot: RPS9 Antibody [NBP2-22298] - Whole cell lysate from HeLa (15 and 50 ug), 293T (50 ug), Jurkat (50 ug), and mouse NIH3T3 (50 ug) cells. NBP2-22298 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunohistochemistry-Paraffin: RPS9 Antibody [NBP2-22298] - Section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti- RPS9 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB. Counterstain: Hematoxylin (blue).
Species: Hu, Mu
Applications: IP (-), WB, IHC, IHC-P
Tbp7 Antibody
NBP1-87799
Western Blot: Tbp7 Antibody [NBP1-87799] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunocytochemistry/Immunofluorescence: Tbp7 Antibody [NBP1-87799] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Tbp7 Antibody [NBP1-87799] - Staining of human gall bladder shows nuclear positivity in glandular cells.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PSMD11 Antibody
NBP1-46191
Western Blot: PSMD11 Antibody [NBP1-46191] - Whole cell lysate from HeLa (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 mcg), and mouse NIH3T3 (M; 50 mcg) cells. Affinity purified rabbit anti-PSMD11 antibody used for WB at 0.04 mcg/ml (A) and 0.4 mcg/ml (B) and used for IP at 3 mcg/mg lysate. PSMD11 was also immunoprecipitated by rabbit anti-PSMD11 antibody NBP1-46192, which recognizes a downstream epitope.
(5 Publications)
Species: Hu, Mu
Applications: WB, IP
Ribosomal Protein
S6/RPS6 Antibody
NB100-1595
Western Blot: Ribosomal Protein S6/RPS6 Antibody [NB100-1595] - Detection of human and mouse RPS6 by western blot. Samples: Whole cell lysate (50 ug) from HeLa, HEK293T, Jurkat, mouse TCMK-1, and mouse NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-RPS6 antibody NB100-1595 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.Previous
Immunohistochemistry-Paraffin: Ribosomal Protein S6/RPS6 Antibody [NB100-1595] - Section of human lung carcinoma. Antibody: Affinity purified rabbit anti-RPS6 (NB100-1595). Detection: DAB
Immunoprecipitation: Ribosomal Protein S6/RPS6 Antibody [NB100-1595] - Detection of human RPS6 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-RPS6 antibody NB100-1595 (lot NB100-1595-2) used for IP at 6 ug per reaction. RPS6 was also immunoprecipitated by a previous lot of this antibody (lot NB100-1595-1). For blotting immunoprecipitated RPS6, NB100-1595 was used at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
PSMD7 Antibody
NBP2-38780
Western Blot: PSMD7 Antibody [NBP2-38780] - Analysis using Anti-PSMD7 antibody NBP2-38780 (A) shows similar pattern to independent antibody NBP2-38612 (B).
Immunocytochemistry/Immunofluorescence: PSMD7 Antibody [NBP2-38780] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780] - Staining of human kidney.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
5-HT1B Antibody
NB100-56350
Western Blot: 5-HT1B Antibody [NB100-56350] - Analysis of 5-HT1B in human brain lysate with anti-5-HT1BR pcAb (NB100-56350). A protein band of approximate molecular weight of 40-41kDa was detected.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
RPS10 Antibody
NBP1-31357
Western Blot: RPS10 Antibody [NBP1-31357] - Sample (50 ug of whole cell lysate) A: Mouse brain 12% SDS PAGE diluted at 1:1000 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: RPS10 Antibody [NBP1-31357] - Sample: HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: RPS10 protein stained by RPS10 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Immunohistochemistry-Paraffin: RPS10 Antibody [NBP1-31357] - Paraffin-embedded mouse colon diluted at 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
PSMD6 Antibody
NBP1-81545
Western Blot: PSMD6 Antibody [NBP1-81545] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: PSMD6 Antibody [NBP1-81545] - Staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PSMD6 Antibody [NBP1-81545] - Staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
L1CAM Antibody
(UJ127.11)
NB100-2682
L1CAM Antibody (UJ127.11)
(1 Publication)
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready, IF
RPS5 Antibody (4H3)
H00006193-M02
Western Blot: RPS5 Antibody (4H3) [H00006193-M02] - RPS5 monoclonal antibody (M02), clone 4H3. Analysis of RPS5 expression in NIH/3T3.
Immunocytochemistry/Immunofluorescence: RPS5 Antibody (4H3) [H00006193-M02] - Analysis of monoclonal antibody to RPS5 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: RPS5 Antibody (4H3) [H00006193-M02] - RPS5 monoclonal antibody (M02), clone 4H3 Analysis of RPS5 expression in HeLa.
(2 Publications)
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
Rpn2 Antibody
NBP2-38323
Western Blot: Rpn2 Antibody [NBP2-38323] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: Rpn2 Antibody [NBP2-38323] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & actin filaments.
Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human liver.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PSMD8 Antibody
NBP1-83254
Western Blot: PSMD8 Antibody [NBP1-83254] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: PSMD8 Antibody [NBP1-83254] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: PSMD8 Antibody [NBP1-83254] - Staining of human testis shows high expression.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Proteasome 19S S7 Antibody (NBP1-87797) (0)

There are no publications for Proteasome 19S S7 Antibody (NBP1-87797).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome 19S S7 Antibody (NBP1-87797) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 2 species: Human, Mouse.

Reviews using NBP1-87797:
Filter by Applications
Simple Western
(1)
WB
(1)
All Applications
Filter by Species
Human
(1)
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Simple Western Proteasome 19S S7 NBP1-87797
Enlarge
reviewed by:
Anonymous
 Simple Western Mouse 08/23/2019
View

Summary

ApplicationSimple Western
Sample TestedMouse Spleen Lysate
SpeciesMouse
LotA107028
 
reviewed by:
Anonymous
 WB Human 08/20/2015
View

Summary

ApplicationWestern Blot
Sample TestedHEK 293 cell lysate20 ug
SpeciesHuman

Blocking

Blocking Details5 % Non-fat milk for 20 minutes at RT

Primary Anitbody

Dilution Ratio1:800

Secondary Antibody

Secondary DescriptionGOAT ANTI-rabbit igG, HRP
Secondary Concentration1:10000

Details

Detection Noteschemiluminescent, GE 4000, 30sec

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proteasome 19S S7 Antibody (NBP1-87797) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Proteasome 19S S7 Products

Bioinformatics Tool for Proteasome 19S S7 Antibody (NBP1-87797)

Discover related pathways, diseases and genes to Proteasome 19S S7 Antibody (NBP1-87797). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteasome 19S S7 Antibody (NBP1-87797)

Discover more about diseases related to Proteasome 19S S7 Antibody (NBP1-87797).
 

Pathways for Proteasome 19S S7 Antibody (NBP1-87797)

View related products by pathway.

PTMs for Proteasome 19S S7 Antibody (NBP1-87797)

Learn more about PTMs related to Proteasome 19S S7 Antibody (NBP1-87797).
 

Research Areas for Proteasome 19S S7 Antibody (NBP1-87797)

Find related products by research area.

Blogs on Proteasome 19S S7

There are no specific blogs for Proteasome 19S S7, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
1
4
1
3
0
2
0
1
0
Simple Western Proteasome 19S S7 NBP1-87797
Enlarge
 Anonymous
08/23/2019
Application: Simple Western
Species: Mouse
read this review
 
 Anonymous
08/20/2015
Application: WB
Species: Human
read this review

Bioinformatics

Gene Symbol PSMC2
Novus 100% Guarantee