Proteasome 19S S7 Antibody

Images

 
Western Blot: Proteasome 19S S7 Antibody [NBP1-87797] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Proteasome 19S S7 Antibody [NBP1-87797] - Staining of human hippocampus shows strong nuclear positivity in neuronal cells.
Simple Western: Proteasome 19S S7 Antibody [NBP1-87797] - Mouse whole spleen lysates at the indicated concentrations were probed with a 1:25 dilution of this Proteasome 19S S7 antibody. Burn-out of the major peak is ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Proteasome 19S S7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAA
Specificity
Specificity of human Proteasome 19S S7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Simple Western
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Proteasome 19S S7 antibody validated for Simple Western from a verified customer review.
Control Peptide
Proteasome 19S S7 Protein (NBP1-87797PEP)
Reviewed Applications
Read 2 Reviews rated 4.5
using
NBP1-87797 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Proteasome 19S S7 Antibody

  • 26S protease regulatory subunit 7
  • 26S proteasome AAA-ATPase subunit RPT1
  • MGC3004
  • MSS1ATPase, 2
  • proteasome (prosome, macropain) 26S subunit, ATPase, 2
  • Protein MSS1
  • putative protein product of Nbla10058

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-94118
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-87372
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-94504
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-73636
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, CyTOF-ready
NBP2-88192
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46191
Species: Hu, Mu
Applications: WB, IP
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-38780
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81545
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2682
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-CS, IF
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83254
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Proteasome 19S S7 Antibody (NBP1-87797) (0)

There are no publications for Proteasome 19S S7 Antibody (NBP1-87797).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome 19S S7 Antibody (NBP1-87797) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 2 species: Human, Mouse.

Reviews using NBP1-87797:
Filter by Applications
Simple Western
(1)
WB
(1)
All Applications
Filter by Species
Human
(1)
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Simple Western Proteasome 19S S7 NBP1-87797
Enlarge
4
reviewed by:
Anonymous
Simple Western Mouse 08/23/2019
View

Summary

ApplicationSimple Western
Sample TestedMouse Spleen Lysate
SpeciesMouse
LotA107028
  5
reviewed by:
Anonymous
WB Human 08/20/2015
View

Summary

ApplicationWestern Blot
Sample TestedHEK 293 cell lysate20 ug
SpeciesHuman

Blocking

Blocking Details5 % Non-fat milk for 20 minutes at RT

Primary Anitbody

Dilution Ratio1:800

Secondary Antibody

Secondary DescriptionGOAT ANTI-rabbit igG, HRP
Secondary Concentration1:10000

Details

Detection Noteschemiluminescent, GE 4000, 30sec

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proteasome 19S S7 Antibody (NBP1-87797) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Proteasome 19S S7 Products

Bioinformatics Tool for Proteasome 19S S7 Antibody (NBP1-87797)

Discover related pathways, diseases and genes to Proteasome 19S S7 Antibody (NBP1-87797). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteasome 19S S7 Antibody (NBP1-87797)

Discover more about diseases related to Proteasome 19S S7 Antibody (NBP1-87797).
 

Pathways for Proteasome 19S S7 Antibody (NBP1-87797)

View related products by pathway.

PTMs for Proteasome 19S S7 Antibody (NBP1-87797)

Learn more about PTMs related to Proteasome 19S S7 Antibody (NBP1-87797).
 

Research Areas for Proteasome 19S S7 Antibody (NBP1-87797)

Find related products by research area.

Blogs on Proteasome 19S S7

There are no specific blogs for Proteasome 19S S7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
1
4
1
3
0
2
0
1
0

Anonymous
08/23/2019
Application: Simple Western
Species: Mouse

 
Anonymous
08/20/2015
Application: WB
Species: Human

Bioinformatics

Gene Symbol PSMC2