Home » Proteasome 19S S7 » Proteasome 19S S7 Antibodies » Proteasome 19S S7 Antibody

Proteasome 19S S7 Antibody

 (2 Reviews)
 
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Proteasome 19S S7 Antibody [NBP1-87797] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Western Blot: Proteasome 19S S7 Antibody [NBP1-87797] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Proteasome 19S S7 Antibody [NBP1-87797] - Staining of human hippocampus shows strong nuclear positivity in neuronal cells.
Simple Western: Proteasome 19S S7 Antibody [NBP1-87797] - Mouse whole spleen lysates at the indicated concentrations were probed with a 1:25 dilution of this Proteasome 19S S7 antibody. Burn-out of the major peak is ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Proteasome 19S S7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Simple Western
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Proteasome 19S S7 antibody validated for Simple Western from a verified customer review.
Control Peptide
Proteasome 19S S7 Protein (NBP1-87797PEP)
Reviewed Applications
Read 2 Reviews rated 4.5
using
NBP1-87797 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Proteasome 19S S7 Antibody

  • 26S protease regulatory subunit 7
  • 26S proteasome AAA-ATPase subunit RPT1
  • MGC3004
  • MSS1ATPase, 2
  • proteasome (prosome, macropain) 26S subunit, ATPase, 2
  • Protein MSS1
  • putative protein product of Nbla10058

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PSMC1 Antibody
NBP1-80959
Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959] - Staining of human testis shows strong nuclear postivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959] - Staining of human prostate shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959] - Staining of human skeletal muscle shows moderate nuclear postivity in myocytes.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Recombinant Human
RPS4Y1 GST (N-Term) P ...
H00006192-P01
SDS-Page: Recombinant Human RPS4Y1 Protein [H00006192-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
(1 Review)
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
RPS4X Antibody
NBP2-94118
Western Blot: RPS4X Antibody [NBP2-94118] - Western blot analysis of extracts of various cell lines, using RPS4X antibody (NBP2-94118) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Species: Hu, Mu, Rt
Applications: WB
SUG1 Antibody
(25D5)
NB100-345
Knockdown Validated: SUG1 Antibody (25D5) [NB100-345] - Representative immunoblot for SUG1 antibody knockdown. Fifty micrograms of total protein was loaded in each lane. Actin was used as a loading control. Image collected and cropped by CiteAb from the following publication (https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3695522/) licensed under a CC-BY licence.
Western Blot: SUG1 Antibody (25D5) [NB100-345] - SUG1 antibody with 30 ug whole cell lysate run on SDS-PAGE. Lane A: 293T; B: A431; C: H1299; D: Hela; E: Hep G2; F: Molt-4; G: Raji 10% SDS PAGE diluted at 1:1000
(2 Reviews)
(4 Publications)
Species: Hu
Applications: ChIP, IP, KD, WB
RPS12 Antibody
NBP2-94504
Immunocytochemistry/Immunofluorescence: RPS12 Antibody [NBP2-94504] - Analysis of MCF-7 cells using RPS12 . Blue: DAPI for nuclear staining.
Western Blot: RPS12 Antibody [NBP2-94504] - Analysis of extracts of various cell lines, using RPS12 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 15s.
Immunocytochemistry/Immunofluorescence: RPS12 Antibody [NBP2-94504] - Confocal immunofluorescence analysis of HeLa cells using RPS12 Polyclonal Antibody (NBP2-94504) at dilution of 1:400. Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
RPS3 Antibody
(SA46-08)
NBP2-67301
Immunocytochemistry/Immunofluorescence: RPS3 Antibody (SA46-08) [NBP2-67301] - Staining RPS3 in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: RPS3 Antibody (SA46-08) [NBP2-67301] - Analysis of paraffin-embedded human kidney tissue using anti-RPS3 antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: RPS3 Antibody (SA46-08) [NBP2-67301] - Analysis of paraffin-embedded mouse lung tissue using anti-RPS3 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Proteasome 19S S3
Antibody (OTI2A2) - A ...
NBP2-73636
Western Blot: Proteasome 19S S3 Antibody (OTI2A2) - Azide and BSA Free [NBP2-73636] - Analysis of extracts (35ug) from 9 different cell lines by using anti-Proteasome 19S S3 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Western Blot: Proteasome 19S S3 Antibody (OTI2A2) - Azide and BSA Free [NBP2-73636] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Proteasome 19S S3 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Prot
Flow Cytometry: Proteasome 19S S3 Antibody (OTI2A2) - Azide and BSA Free [NBP2-73636] - Analysis of Hela cells, using anti-Proteasome 19S S3 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
Recombinant Human
RPS8 GST (N-Term) Pro ...
H00006202-Q01
SDS-Page: Recombinant Human RPS8 Protein [H00006202-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
RPS9 Antibody
NBP2-88192
Immunohistochemistry-Paraffin: RPS9 Antibody [NBP2-88192] - Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver. Observed Staining: Cytoplasm in hepatocytes, strong signal, very wide tissue distribution. Primary Antibody Concentration: 1:100.
Immunohistochemistry-Paraffin: RPS9 Antibody [NBP2-88192] - Rabbit Anti-RPS9 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver. Observed Staining: Cytoplasm in hepatocytes. Primary Antibody Concentration: 1:600. Secondary Antibody: Donkey anti-Rabbit-Cy3.
Western Blot: RPS9 Antibody [NBP2-88192] - WB Suggested Anti-RPS9 Antibody. Titration: 1.0 ug/ml. Positive Control: Hela Whole CellRPS9 is supported by BioGPS gene expression data to be expressed in HeLa
Species: Hu
Applications: IHC, IHC-P, WB
Tbp7 Antibody
NBP1-87799
Immunohistochemistry-Paraffin: Tbp7 Antibody [NBP1-87799] - Staining of human gall bladder shows nuclear positivity in glandular cells.
Western Blot: Tbp7 Antibody [NBP1-87799] - Analysis in human cell line A-549.
Western Blot: Tbp7 Antibody [NBP1-87799] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PSMD11 Antibody
NBP1-46191
Western Blot: PSMD11 Antibody [NBP1-46191] - Treatment of human skin fibroblasts with 6BIO activated proteostatic modules. Representative immunoblot analyses of the autophagy-related Beclin1 and the 26S proteasome subunits Rpn6 (PSMD11), Rpt6, alpha7 and beta5 expression levels after cell exposure to the shown concentrations of 6BIO for 36 h. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-017-11662-7), licensed under a CC-BY licence.
Western Blot: PSMD11 Antibody [NBP1-46191] - Whole cell lysate from HeLa (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 mcg), and mouse NIH3T3 (M; 50 mcg) cells. Affinity purified rabbit anti-PSMD11 antibody used for WB at 0.04 mcg/ml (A) and 0.4 mcg/ml (B) and used for IP at 3 mcg/mg lysate. PSMD11 was also immunoprecipitated by rabbit anti-PSMD11 antibody NBP1-46192, which recognizes a downstream epitope.
(10 Publications)
Species: Dr, Hu, Mu
Applications: IP, WB
Ribosomal Protein
S6/RPS6 Antibody
NB100-1595
Immunohistochemistry-Paraffin: Ribosomal Protein S6/RPS6 Antibody [NB100-1595] - Section of human lung carcinoma. Antibody: Affinity purified rabbit anti-RPS6 (NB100-1595). Detection: DAB
Western Blot: Ribosomal Protein S6/RPS6 Antibody [NB100-1595] - Detection of human and mouse RPS6 by western blot. Samples: Whole cell lysate (50 ug) from HeLa, HEK293T, Jurkat, mouse TCMK-1, and mouse NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-RPS6 antibody NB100-1595 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.Previous
Immunoprecipitation: Ribosomal Protein S6/RPS6 Antibody [NB100-1595] - Detection of human RPS6 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-RPS6 antibody NB100-1595 (lot NB100-1595-2) used for IP at 6 ug per reaction. RPS6 was also immunoprecipitated by a previous lot of this antibody (lot NB100-1595-1). For blotting immunoprecipitated RPS6, NB100-1595 was used at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
PSMD7 Antibody
NBP2-38780
Immunocytochemistry/Immunofluorescence: PSMD7 Antibody [NBP2-38780] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PSMD7 Antibody [NBP2-38780] - Staining of human cerebral cortex, colon, kidney and testis using Anti-PSMD7 antibody NBP2-38780 (A) shows similar protein distribution across tissues to independent antibody NBP2-38612 (B).
Western Blot: PSMD7 Antibody [NBP2-38780] - Analysis using Anti-PSMD7 antibody NBP2-38780 (A) shows similar pattern to independent antibody NBP2-38612 (B).
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
5-HT1B Antibody
NB100-56350
Western Blot: 5-HT1B Antibody [NB100-56350] - Analysis of 5-HT1B in human brain lysate with anti-5-HT1BR pcAb (NB100-56350). A protein band of approximate molecular weight of 40-41kDa was detected.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
RPS10 Antibody
NBP2-94502
Immunocytochemistry/Immunofluorescence: RPS10 Antibody [NBP2-94502] - Analysis of MCF7 cells using RPS10 . Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: RPS10 Antibody [NBP2-94502] - Mouse brain using RPS10 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: RPS10 Antibody [NBP2-94502] - Rat brain using RPS10 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
PSMD6 Antibody
NBP1-81545
Immunocytochemistry/Immunofluorescence: PSMD6 Antibody [NBP1-81545] - Staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PSMD6 Antibody [NBP1-81545] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.
Immunohistochemistry-Paraffin: PSMD6 Antibody [NBP1-81545] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
L1CAM Antibody
(UJ127.11) - BSA Free
NB100-2682
Flow Cytometry: L1CAM Antibody (UJ127.11) [NB100-2682] - A surface stain was performed on HeLa cells with L1CAM Antibody (UJ127.11) NB100-2682 (blue) and a matched isotype control (orange). Cells were incubated in an antibody dilution of 2.5 ug/mL for 20 minutes at room temperature, followed by Mouse IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550 (35503, Thermo Fisher).
Western Blot: L1CAM Antibody (UJ127.11) [NB100-2682] - Total protein from human HeLa, A431 and SHSY-5Y cell lines and human Brain was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-L1CAM (NB100-2682) in blocking buffer and detected with an anti-mouse HRP secondary antibody using NovaLume chemiluminescence detection reagent (NPB2-61915).
Immunohistochemistry-Paraffin: L1CAM Antibody (UJ127.11) [NB100-2682] - Analysis of a FFPE tissue section of human brain using 1:200 dilution of L1CAM [UJ127.11] antibody. The staining was developed using HRP labeled anti-mouse secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. Cytoplasmic and membrane staining as observed in the cerebral cortex
(2 Reviews)
(2 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, WB
RPS5 Antibody (4H3)
H00006193-M02
ELISA: RPS5 Antibody (4H3) [H00006193-M02] - Detection limit for recombinant GST tagged RPS5 is approximately 3ng/ml as a capture antibody.
Western Blot: RPS5 Antibody (4H3) [H00006193-M02] - Analysis of RPS5 expression in transfected 293T cell line by RPS5 monoclonal antibody (M02), clone 4H3.Lane 1: RPS5 transfected lysate(22.9 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: RPS5 Antibody (4H3) [H00006193-M02] - Analysis of monoclonal antibody to RPS5 on HeLa cell. Antibody concentration 10 ug/ml.
(2 Publications)
Species: Hu, Mu, Pr, Rt
Applications: ELISA, ICC/IF, WB
Rpn2 Antibody
NBP2-38323
Immunocytochemistry/Immunofluorescence: Rpn2 Antibody [NBP2-38323] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & actin filaments.
Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human cerebral cortex, kidney, liver and testis using Anti-PSMD1 antibody NBP2-38323 (A) shows similar protein distribution across tissues to independent antibody NBP2-38324 (B).
Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human testis.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PSMD8 Antibody
NBP1-83254
Immunocytochemistry/Immunofluorescence: PSMD8 Antibody [NBP1-83254] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: PSMD8 Antibody [NBP1-83254] - Staining of human cerebellum shows moderate nuclear positivity in Purkinje cells.
Immunohistochemistry-Paraffin: PSMD8 Antibody [NBP1-83254] - Staining of human pancreas shows very weak positivity in exocrine glandular cells as expected.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Proteasome 19S S7 Antibody (NBP1-87797) (0)

There are no publications for Proteasome 19S S7 Antibody (NBP1-87797).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome 19S S7 Antibody (NBP1-87797) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 2 species: Human, Mouse.

Reviews using NBP1-87797:
Filter by Applications
Simple Western
(1)
Western Blot
(1)
All Applications
Filter by Species
Human
(1)
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Simple Western Proteasome 19S S7 NBP1-87797
Enlarge 		4
reviewed by:
Julian Wong
 Simple Western Mouse 08/23/2019
View

Summary

ApplicationSimple Western
Sample TestedMouse Spleen Lysate
SpeciesMouse
LotA107028
  5
reviewed by:
Grace zhou
 Western Blot Human 08/20/2015
View

Summary

ApplicationWestern Blot
Sample TestedHEK 293 cell lysate20 ug
SpeciesHuman

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proteasome 19S S7 Antibody (NBP1-87797) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Proteasome 19S S7 Products

Bioinformatics Tool for Proteasome 19S S7 Antibody (NBP1-87797)

Discover related pathways, diseases and genes to Proteasome 19S S7 Antibody (NBP1-87797). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteasome 19S S7 Antibody (NBP1-87797)

Discover more about diseases related to Proteasome 19S S7 Antibody (NBP1-87797).
 

Pathways for Proteasome 19S S7 Antibody (NBP1-87797)

View related products by pathway.

PTMs for Proteasome 19S S7 Antibody (NBP1-87797)

Learn more about PTMs related to Proteasome 19S S7 Antibody (NBP1-87797).
 

Research Areas for Proteasome 19S S7 Antibody (NBP1-87797)

Find related products by research area.

Blogs on Proteasome 19S S7

There are no specific blogs for Proteasome 19S S7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
1
4
1
3
0
2
0
1
0
Simple Western Proteasome 19S S7 NBP1-87797
Enlarge
 Julian Wong
08/23/2019
Application: Simple Western
Species: Mouse
read this review
 
 Grace zhou
08/20/2015
Application: Western Blot
Species: Human
read this review

Bioinformatics

Gene Symbol PSMC2