Proteasome 19S S7 Antibody

Western Blot: Proteasome 19S S7 Antibody [NBP1-87797] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: Proteasome 19S S7 Antibody [NBP1-87797] - Staining of human hippocampus shows strong nuclear positivity in neuronal cells.

Simple Western: Proteasome 19S S7 Antibody [NBP1-87797] - Mouse whole spleen lysates at the indicated concentrations were probed with a 1:25 dilution of this Proteasome 19S S7 antibody. Burn-out of the major peak is beginning at 0.5 mg/mL. Simple Western image submitted by a verified customer review.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Proteasome 19S S7 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSMC2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Simple Western
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Proteasome 19S S7 antibody validated for Simple Western from a verified customer review.
• Control Peptide:

  Proteasome 19S S7 Protein (NBP1-87797PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Proteasome 19S S7 Antibody

• 26S protease regulatory subunit 7
• 26S proteasome AAA-ATPase subunit RPT1
• MGC3004
• MSS1ATPase, 2
• proteasome (prosome, macropain) 26S subunit, ATPase, 2
• Protein MSS1
• putative protein product of Nbla10058

Background

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. This subunit has been shown to interact with several of the basal transcription factors so, in addition to participation in proteasome functions, this subunit may participate in the regulation of transcription. This subunit may also compete with PSMC3 for binding to the HIV tat protein to regulate the interaction between the viral protein and the transcription complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Reviews for Proteasome 19S S7 Antibody (NBP1-87797) (2)

Average Rating: 4.5

(Based on 2 reviews)

We have 2 reviews tested in 2 species: Human, Mouse.

reviewed by: Verified Customer Simple Western Mouse 08/23/2019

Summary

• Application: Simple Western
• Sample Tested: Mouse Spleen Lysate
• Species: Mouse
• Lot: A107028

reviewed by: Verified Customer WB Human 08/20/2015

Summary

• Application: Western Blot
• Sample Tested: HEK 293 cell lysate20 ug
• Species: Human

Bioinformatics

• Gene Symbol: PSMC2