TRIM72 Antibody

Images

 
Immunohistochemistry-Paraffin: TRIM72 Antibody [NBP2-49157] - Staining of human skin shows low expression as expected.
Immunohistochemistry: TRIM72 Antibody [NBP2-49157] - Staining of human skeletal muscle shows cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: TRIM72 Antibody [NBP2-49157] - Staining in human skeletal muscle and skin tissues using anti-TRIM72 antibody. Corresponding TRIM72 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIM72 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLVGPE
Specificity
Specificity of human TRIM72 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM72
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TRIM72 Recombinant Protein Antigen (NBP2-49157PEP)

Reactivity Notes

Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRIM72 Antibody

  • MG53Mg53
  • Mitsugumin-53
  • tripartite motif containing 72
  • tripartite motif-containing 72
  • tripartite motif-containing protein 72

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-5029
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-66814
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-49156
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-66943
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-38498
Species: Hu
Applications: IHC, IHC-P
NBP1-80220
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49157
Species: Hu
Applications: IHC, IHC-P

Publications for TRIM72 Antibody (NBP2-49157) (0)

There are no publications for TRIM72 Antibody (NBP2-49157).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM72 Antibody (NBP2-49157) (0)

There are no reviews for TRIM72 Antibody (NBP2-49157). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TRIM72 Antibody (NBP2-49157) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TRIM72 Antibody (NBP2-49157)

Discover related pathways, diseases and genes to TRIM72 Antibody (NBP2-49157). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM72 Antibody (NBP2-49157)

Discover more about diseases related to TRIM72 Antibody (NBP2-49157).
 

Pathways for TRIM72 Antibody (NBP2-49157)

View related products by pathway.

Research Areas for TRIM72 Antibody (NBP2-49157)

Find related products by research area.

Blogs on TRIM72

There are no specific blogs for TRIM72, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM72 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM72