TRIM72 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LKTQLPQQKLQLQEACMRKEKSVAVLEHQLVEVEETVRQFRGAVGEQLGKMRVFLAALEGSLDREAERVRGE |
| Predicted Species |
Mouse (93%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TRIM72 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TRIM72 Antibody - BSA Free
Background
Muscle-specific protein that plays a central role in cell membrane repair by nucleating the assembly of therepair machinery at injury sites. Specifically binds phosphatidylserine. Acts as a sensor of oxidation: upon membranedamage, entry of extracellular oxidative environment results in disulfide bond formation and homooligomerization atthe injury site. This oligomerization acts as a nucleation site for recruitment of TRIM72-containing vesicles to theinjury site, leading to membrane patch formation. Probably acts upstream of the Ca(2+)-dependent membrane resealingprocess. Required for transport of DYSF to sites of cell injury during repair patch formation. Regulates membranebudding and exocytosis. May be involved in the regulation of the mobility of KCNB1-containing endocytic vesicles (Bysimilarity)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Bv, Hu, Po, Sh
Applications: ELISA, Flow, ICC/IF, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, PLA, S-ELISA, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, KO, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF
Publications for TRIM72 Antibody (NBP1-86000) (0)
There are no publications for TRIM72 Antibody (NBP1-86000).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TRIM72 Antibody (NBP1-86000) (0)
There are no reviews for TRIM72 Antibody (NBP1-86000).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TRIM72 Antibody (NBP1-86000) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TRIM72 Products
Research Areas for TRIM72 Antibody (NBP1-86000)
Find related products by research area.
|
Blogs on TRIM72