TRIM72 Antibody (2G1) Summary
Immunogen |
TRIM72 (NP_001008275.1, 378 a.a. ~ 477 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLVGPEGAEA |
Specificity |
Reacts with tripartite motif-containing 72. |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
TRIM72 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunoprecipitation
- Sandwich ELISA
|
Application Notes |
This antibody is reactive against recombinant protein in ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for TRIM72 Antibody (2G1)
Background
Muscle-specific protein that plays a central role in cell membrane repair by nucleating the assembly of therepair machinery at injury sites. Specifically binds phosphatidylserine. Acts as a sensor of oxidation: upon membranedamage, entry of extracellular oxidative environment results in disulfide bond formation and homooligomerization atthe injury site. This oligomerization acts as a nucleation site for recruitment of TRIM72-containing vesicles to theinjury site, leading to membrane patch formation. Probably acts upstream of the Ca(2+)-dependent membrane resealingprocess. Required for transport of DYSF to sites of cell injury during repair patch formation. Regulates membranebudding and exocytosis. May be involved in the regulation of the mobility of KCNB1-containing endocytic vesicles (Bysimilarity)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, PLA, S-ELISA, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, KO, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IP
Publications for TRIM72 Antibody (H00493829-M01) (0)
There are no publications for TRIM72 Antibody (H00493829-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TRIM72 Antibody (H00493829-M01) (0)
There are no reviews for TRIM72 Antibody (H00493829-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for TRIM72 Antibody (H00493829-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TRIM72 Products
Bioinformatics Tool for TRIM72 Antibody (H00493829-M01)
Discover related pathways, diseases and genes to TRIM72 Antibody (H00493829-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for TRIM72 Antibody (H00493829-M01)
Discover more about diseases related to TRIM72 Antibody (H00493829-M01).
| | Pathways for TRIM72 Antibody (H00493829-M01)
View related products by pathway.
|
Research Areas for TRIM72 Antibody (H00493829-M01)
Find related products by research area.
|
Blogs on TRIM72