Home » TRIM72 » TRIM72 Antibodies » TRIM72 Antibody (2G1)

TRIM72 Antibody (2G1)

 Submit a Review

Images

 
(
Enlarge)
Sandwich ELISA: TRIM72 Antibody (2G1) [H00493829-M01] - Detection limit for recombinant GST tagged TRIM72 is 0.1 ng/ml as a capture antibody.
Sandwich ELISA: TRIM72 Antibody (2G1) [H00493829-M01] - Detection limit for recombinant GST tagged TRIM72 is 0.1 ng/ml as a capture antibody.
Immunoprecipitation: TRIM72 Antibody (2G1) [H00493829-M01] - Analysis of TRIM72 transfected lysate using anti-TRIM72 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TRIM72 MaxPab rabbit ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IP, S-ELISA
Clone
2G1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TRIM72 Antibody (2G1) Summary

Immunogen
TRIM72 (NP_001008275.1, 378 a.a. ~ 477 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLVGPEGAEA
Specificity
Reacts with tripartite motif-containing 72.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TRIM72
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
Application Notes
This antibody is reactive against recombinant protein in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TRIM72 Antibody (2G1)

  • MG53Mg53
  • Mitsugumin-53
  • tripartite motif containing 72
  • tripartite motif-containing 72
  • tripartite motif-containing protein 72

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Caveolin-3 Antibody
NB110-5029
Western Blot: Caveolin-3 Antibody [NB110-5029] - Analysis of rat cardiac muscle protein extract.
Immunocytochemistry/Immunofluorescence: Caveolin-3 Antibody [NB110-5029] - C2C11 cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with a Caveolin 3 polyclonal antibody at a dilution of 1:20 overnight at 4 C, washed with PBS and incubated with a DyLight-488 conjugated secondary antibody and nuclei with DAPI (blue) is shown.
Immunohistochemistry-Paraffin: Caveolin-3 Antibody [NB110-5029] - Normal biopsies of deparaffinized Mouse skeletal muscle tissue.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Dysferlin Antibody
(JF05-54)
NBP2-66814
Western Blot: Dysferlin Antibody (JF05-54) [NBP2-66814] - Analysis of Dysferlin on human skeletal muscle lysates using anti-Dysferlin antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: Dysferlin Antibody (JF05-54) [NBP2-66814] - Staining Dysferlin in SW480 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Dysferlin Antibody (JF05-54) [NBP2-66814] - Analysis of paraffin-embedded mouse spleen tissue using anti-Dysferlin antibody. Counter stained with hematoxylin.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
TRIM Antibody
[Unconjugated]
AF4708
Western blot shows lysates of human peripheral blood mononuclear cells and Jurkat human acute T cell leukemia cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human TRIM Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4708) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for TRIM at approximately 27 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Human CD3+ T cells from peripheral blood mononuclear cells were stained with Goat Anti-Human TRIM Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4708, filled histo­gram) or isotype control antibody (Catalog #AB-108-C, open histo­gram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
Insulin Receptor
beta Antibody
NBP2-12793
Immunohistochemistry-Paraffin: Insulin Receptor beta Antibody [NBP2-12793] - Staining shows expression of insulin receptor beta in the Cortex in mouse brain. Dilution 1:500
Immunoprecipitation: Insulin Receptor beta Antibody [NBP2-12793] - Samples: Whole cell lysate from HeLa (15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 ug), Jurkat (J; 50 ug) and mouse NIH3T3 (M; 50 ug) cells. Antibodies: Affinity purified rabbit anti-Insulin Receptor Beta antibody NBP2-12793 used for WB at 0.1 ug/ml (A) and 1 ug/ml (B) and used for IP at 6 ug/mg lysate. Insulin Receptor Beta was also immunoprecipitated by rabbit anti-Insulin Receptor Beta antibody, which recognizes an upstream epitope. Detection: Chemiluminescence with exposure times of 30 seconds (A and B).
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(23 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
TRIM17 Antibody
(2E11)
H00051127-M01
Immunocytochemistry/Immunofluorescence: TRIM17 Antibody (2E11) [H00051127-M01] - Analysis of monoclonal antibody to TRIM17 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: TRIM17 Antibody (2E11) [H00051127-M01] - Detection limit for recombinant GST tagged TRIM17 is 0.03 ng/ml as a capture antibody.
(1 Publication)
Species: Hu
Applications: WB, ELISA, ICC/IF, PLA, S-ELISA
MEF2A Antibody
(JA33-04)
NBP2-66943
Western Blot: MEF2A Antibody (JA33-04) [NBP2-66943] - Analysis of MEF2A on rat spleen tissue lysate using anti-MEF2A antibody at 1/1,000 dilution.
Immunohistochemistry-Paraffin: MEF2A Antibody (JA33-04) [NBP2-66943] - Analysis of paraffin-embedded mouse spleen tissue using anti-MEF2A antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: MEF2A Antibody (JA33-04) [NBP2-66943] - Analysis of paraffin-embedded human spleen tissue using anti-MEF2A antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MID1 Antibody
NBP3-05061
Western Blot: MID1 Antibody [NBP3-05061] - analysis of extracts of HeLa cells, using MID1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 60s.
Immunocytochemistry/Immunofluorescence: MID1 Antibody [NBP3-05061] - Analysis of MCF-7 cells using MID1 antibody. Blue: DAPI for nuclear staining.
Western Blot: MID1 Antibody [NBP3-05061] - Analysis of extracts of various cell lines, using MID1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit
Species: Hu, Mu
Applications: WB, ICC/IF
KCNB1 Antibody
NBP2-38498
Immunohistochemistry-Paraffin: KCNB1 Antibody [NBP2-38498] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: KCNB1 Antibody [NBP2-38498] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: KCNB1 Antibody [NBP2-38498] - Staining in human cerebral cortex and pancreas tissues using anti-KCNB1 antibody. Corresponding KCNB1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
PTRF Antibody
NBP1-80220
Western Blot: PTRF Antibody [NBP1-80220] - Sample Tissue: Mouse Lung Antibody Dilution: 1.0ug/ml
Immunohistochemistry-Paraffin: PTRF Antibody [NBP1-80220] - Mouse vessel and adipocytes (skeletal muscle), 5 ug/ml.
Western Blot: PTRF Antibody [NBP1-80220] - NIH/3T3 cell lysate, Antibody Titration: 0.625ug/ml
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, KO
MyoD Antibody
(5.8A)
NB100-56511
Western Blot: MyoD Antibody (5.8A) [NB100-56511] - Analysis for MyoD expression in various small round cell tumor lines using 1 ug/mL anti-MyoD mAb. The antibody only reacts with a band of approx. 45 kDa in the rhabdomyosarcoma cell line (Rh30, lane 1) but was negative against the primitive neuroectodermal (PFSK-1A, lane 2), lymphoma (EB2, lane 3), neuroblastoma (SK-N-SH, lane 4), and Ewing's sarcoma (SJSA-1, lane 5) cell lines.
Immunocytochemistry/Immunofluorescence: MyoD Antibody (5.8A) [NB100-56511] - Human myoblasts were stained with MyoD1 antibody, diluted 1:200. ICC/IF image submitted by a verified customer review.
Immunohistochemistry-Frozen: MyoD Antibody (5.8A) [NB100-56511] - Clone 5.8A antibody in human tissues. A. Rhabdomyosaroma (nuclei are stained), B. Lymphoma (staining is absent)
(2 Reviews)
(16 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO
IRS1 Antibody
NB100-82001
Western Blot: IRS1 Antibody [NB100-82001] - Analysis of extracts from 293 cells using IRS-1 (Ab-636) antibody
Immunocytochemistry/Immunofluorescence: IRS1 Antibody [NB100-82001] - Staining of methanol-fixed Hela cells using IRS-1 (Ab-636) antibody
Immunohistochemistry-Paraffin: IRS1 Antibody [NB100-82001] - Analysis of breast carcinoma tissue, using IRS-1 (Ab-636) antibody.
(3 Publications)
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Myogenin Antibody
(5FD)
NB100-56510
Western Blot: Myogenin Antibody (5FD) [NB100-56510] - Analysis of Myogenin expression in various small-round cell tumor lines. The antibody strongly reacted with a band at ~34 kDa in alveolar rhobdomyosarcoma line (Rh30). Negative cell lines were PFSK-1, EB2, SK-N-SH, and SJSA-1.
Immunohistochemistry: Myogenin Antibody (5FD) [NB100-56510] - Human myocytes using NB100-56703 at 2.5 ug/mL. Hematoxylin-eosin counterstain.
Immunohistochemistry-Frozen: Myogenin Antibody (5FD) [NB100-56510] - Analysis of Myogenin in human alveolar rhabdomyosarcoma using NB100-56510 at 5 ug/mL.
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
ARHGEF7 Antibody
NBP1-88650
Western Blot: ARHGEF7 Antibody [NBP1-88650] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: ARHGEF7 Antibody [NBP1-88650] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Western Blot: ARHGEF7 Antibody [NBP1-88650] - Analysis in human cell line SH-SY5Y.
Species: Hu
Applications: WB, IHC, IHC-P, KD
PIK3CA Antibody
NBP2-19804
Western Blot: PIK3CA Antibody [NBP2-19804] - Various whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with PI3 kinase p110 alpha antibody diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: PIK3CA Antibody [NBP2-19804] - HCT 116 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: PI3 kinase p110 alpha protein stained by PI3 kinase p110 alpha antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: PIK3CA Antibody [NBP2-19804] - PIK3CA Antibody Immunohistochemical analysis of paraffin-embedded Human Breast Cancer, using PI3 kinase p110 alpha antibody.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
PI 3-Kinase p110
beta/PIK3CB Antibody ...
NBP2-88937
Western Blot: PI 3-Kinase p110 beta/PIK3CB Antibody (CL9518) [NBP2-88937] - Analysis in human cell line HEL.
Immunocytochemistry/Immunofluorescence: PI 3-Kinase p110 beta/PIK3CB Antibody (CL9518) [NBP2-88937] - Staining of A-431 cells using the Anti-PIK3CB monoclonal antibody, showing specific staining in the nucleoplasm and cytosol in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
Immunohistochemistry-Paraffin: PI 3-Kinase p110 beta/PIK3CB Antibody (CL9518) [NBP2-88937] - Staining of human thyroid gland shows strong nuclear positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
TRIM72 Antibody
(2G1)
H00493829-M01
TRIM72 Antibody (2G1)
Species: Hu
Applications: ELISA, IP, S-ELISA

Publications for TRIM72 Antibody (H00493829-M01) (0)

There are no publications for TRIM72 Antibody (H00493829-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM72 Antibody (H00493829-M01) (0)

There are no reviews for TRIM72 Antibody (H00493829-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TRIM72 Antibody (H00493829-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional TRIM72 Products

Bioinformatics Tool for TRIM72 Antibody (H00493829-M01)

Discover related pathways, diseases and genes to TRIM72 Antibody (H00493829-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM72 Antibody (H00493829-M01)

Discover more about diseases related to TRIM72 Antibody (H00493829-M01).
 

Pathways for TRIM72 Antibody (H00493829-M01)

View related products by pathway.

Research Areas for TRIM72 Antibody (H00493829-M01)

Find related products by research area.

Blogs on TRIM72

There are no specific blogs for TRIM72, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM72 Antibody (2G1) and receive a gift card or discount.


Bioinformatics

Gene Symbol TRIM72
Entrez
Uniprot