Reactivity | HuSpecies Glossary |
Applications | ELISA, IP, S-ELISA |
Clone | 2G1 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | TRIM72 (NP_001008275.1, 378 a.a. ~ 477 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLVGPEGAEA |
Specificity | Reacts with tripartite motif-containing 72. |
Isotype | IgG2a Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | TRIM72 |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | This antibody is reactive against recombinant protein in ELISA. |
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | In 1x PBS, pH 7.4 |
Preservative | No Preservative |
Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Diseases for TRIM72 Antibody (H00493829-M01)Discover more about diseases related to TRIM72 Antibody (H00493829-M01).
| Pathways for TRIM72 Antibody (H00493829-M01)View related products by pathway.
|
Research Areas for TRIM72 Antibody (H00493829-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | TRIM72 |
Entrez |
|
Uniprot |
|