TRIM67 Antibody

Images

 
Western Blot: TRIM67 Antibody [NBP1-55028] - HepG2 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

TRIM67 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to TRIM67(tripartite motif-containing 67) The peptide sequence was selected from the C terminal of TRIM67. Peptide sequence GGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGVFMPALSLNRN. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM67
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for TRIM67 Antibody

  • FLJ44831
  • TNLTRIM9-like protein TNL
  • TRIM9-like protein
  • tripartite motif containing 67
  • tripartite motif-containing 67
  • tripartite motif-containing protein 67

Background

The specific function of TRIM67 is not yet known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
NB100-143
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, KD, KO, PAGE, WB
NBP1-80992
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00006187-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-83510
Species: Hu
Applications: WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NB100-93325
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-23718
Species: Bv, Eq, Hu, Pm
Applications: IHC, IHC-P
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB100-1595
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-37000
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-29328
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo
H00006193-M02
Species: Hu, Mu, Pr, Rt
Applications: ELISA, ICC/IF, WB
NBP1-87892
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP1-91746
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83213
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB

Publications for TRIM67 Antibody (NBP1-55028) (0)

There are no publications for TRIM67 Antibody (NBP1-55028).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM67 Antibody (NBP1-55028) (0)

There are no reviews for TRIM67 Antibody (NBP1-55028). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM67 Antibody (NBP1-55028) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIM67 Products

Diseases for TRIM67 Antibody (NBP1-55028)

Discover more about diseases related to TRIM67 Antibody (NBP1-55028).
 

Pathways for TRIM67 Antibody (NBP1-55028)

View related products by pathway.

Blogs on TRIM67

There are no specific blogs for TRIM67, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM67 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM67