TRIM58 Antibody - BSA Free

Western Blot: TRIM58 Antibody [NBP1-88608] - Analysis in human cell line PC-3 and human cell line CACO-2.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TRIM58 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EAGEISFYNVTDGSYIYTFNQLFSGLLRPYFFICDATPLILPPTTIAGSGNWASRDHLDPASDVRDDHL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRIM58
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.04-0.4 ug/ml
• Control Peptide:

  TRIM58 Protein (NBP1-88608PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TRIM58 Antibody - BSA Free

• BIA2
• DKFZp434C091
• Protein BIA2
• tripartite motif containing 58
• tripartite motif-containing 58
• tripartite motif-containing protein 58

Background

TRIM58 - tripartite motif-containing 58

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TRIM58 Antibody (NBP1-88608)(2)

Publications using NBP1-88608

• Sun N, Shen J, Shi Y et al. TRIM58 functions as a tumor suppressor in colorectal cancer by promoting RECQL4 ubiquitination to inhibit the AKT signaling pathway World journal of surgical oncology 2023-07-29 [PMID: 37516854] (IHC-P, Human)
• Liu M, Zhang X, Cai J et al. Downregulation of TRIM58 expression is associated with a poor patient outcome and enhances colorectal cancer cell invasion. Oncol. Rep. 2018-09-01 [PMID: 29956813] (WB, Human)

Bioinformatics

• Gene Symbol: TRIM58