TRIM58 Antibody


Immunohistochemistry-Paraffin: TRIM58 Antibody [NBP1-88608] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

TRIM58 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:EAGEISFYNVTDGSYIYTFNQLFSGLLRPYFFICDATPLILPPTTIAGSGNWASRDHLDPASDVRDDHL
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TRIM58 Protein (NBP1-88608PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TRIM58 Antibody

  • BIA2
  • DKFZp434C091
  • Protein BIA2
  • tripartite motif containing 58
  • tripartite motif-containing 58
  • tripartite motif-containing protein 58


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC-Fr
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC, Block, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Pm, Ze
Applications: WB
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TRIM58 Antibody (NBP1-88608) (0)

There are no publications for TRIM58 Antibody (NBP1-88608).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM58 Antibody (NBP1-88608) (0)

There are no reviews for TRIM58 Antibody (NBP1-88608). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TRIM58 Antibody (NBP1-88608) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TRIM58 Products

Bioinformatics Tool for TRIM58 Antibody (NBP1-88608)

Discover related pathways, diseases and genes to TRIM58 Antibody (NBP1-88608). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM58 Antibody (NBP1-88608)

Discover more about diseases related to TRIM58 Antibody (NBP1-88608).

Pathways for TRIM58 Antibody (NBP1-88608)

View related products by pathway.

PTMs for TRIM58 Antibody (NBP1-88608)

Learn more about PTMs related to TRIM58 Antibody (NBP1-88608).

Research Areas for TRIM58 Antibody (NBP1-88608)

Find related products by research area.

Blogs on TRIM58

There are no specific blogs for TRIM58, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TRIM58 Antibody and receive a gift card or discount.


Gene Symbol TRIM58