MPPED2 Antibody


Western Blot: MPPED2 Antibody [NBP1-80499] - MPPED2 reduces cell proliferation of breast carcinoma cell lines. qRT-PCR (left panel) performed in MDA-MB-231 and SKBR3 cells stably expressing MPPED2 or carrying the more
Western Blot: MPPED2 Antibody [NBP1-80499] - A204 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB

Order Details

MPPED2 Antibody Summary

Synthetic peptide directed towards the C terminal of human MPPED2. Peptide sequence PKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Zebrafish (100%), Rabbit (100%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against MPPED2 and was validated on Western blot.
Read Publication using
NBP1-80499 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MPPED2 Antibody

  • 239FBchromosome 11 open reading frame 8
  • C11orf8dJ1024C24.1
  • D11S302E
  • dJ873F21.1
  • EC 3.1
  • FAM1B
  • Fetal brain protein 239
  • metallophosphoesterase domain containing 2
  • Metallophosphoesterase domain-containing protein 2
  • metallophosphoesterase MPPED2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, IHC, Block, ICC
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu, Mu, Rt, Fi, Pm, Pm, Sh
Applications: WB, ICC/IF, IHC, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Ze
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, Ze
Applications: WB

Publications for MPPED2 Antibody (NBP1-80499)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for MPPED2 Antibody (NBP1-80499) (0)

There are no reviews for MPPED2 Antibody (NBP1-80499). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MPPED2 Antibody (NBP1-80499) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional MPPED2 Products

Bioinformatics Tool for MPPED2 Antibody (NBP1-80499)

Discover related pathways, diseases and genes to MPPED2 Antibody (NBP1-80499). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MPPED2 Antibody (NBP1-80499)

Discover more about diseases related to MPPED2 Antibody (NBP1-80499).

Pathways for MPPED2 Antibody (NBP1-80499)

View related products by pathway.

Research Areas for MPPED2 Antibody (NBP1-80499)

Find related products by research area.

Blogs on MPPED2

There are no specific blogs for MPPED2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MPPED2 Antibody and receive a gift card or discount.


Gene Symbol MPPED2