MPPED2 Antibody

Western Blot: MPPED2 Antibody [NBP1-80499] - MPPED2 reduces cell proliferation of breast carcinoma cell lines. qRT-PCR (left panel) performed in MDA-MB-231 and SKBR3 cells stably expressing MPPED2 or carrying the corresponding empty vector (EV). Data are reported as 2-delatadelataCt values +/- SD, compared to the EV, set equal to 1. Western blot (right panel) analysis confirming the expression of MPPED2. beta-actin was used to normalize the amount of loaded protein (left panel). Densitometric analysis was performed by using ImageJ software to evaluate MPPED2 protein expression compared to EV, set equal to 1. Original blots were shown in Supplementary Materials Figure S5. Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/2072-6694/11/6/797) licensed under a CC-BY licence.

Western Blot: MPPED2 Antibody [NBP1-80499] - A204 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

MPPED2 Antibody Summary

• Immunogen: Synthetic peptide directed towards the C terminal of human MPPED2. Peptide sequence PKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MPPED2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against MPPED2 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MPPED2 Antibody

• 239FBchromosome 11 open reading frame 8
• C11orf8dJ1024C24.1
• D11S302E
• dJ873F21.1
• EC 3.1
• FAM1B
• Fetal brain protein 239
• metallophosphoesterase domain containing 2
• Metallophosphoesterase domain-containing protein 2
• metallophosphoesterase MPPED2

Background

MPPED2 likely encodes a metallophosphoesterase. The encoded protein may play a role a brain development. Alternatively spliced transcript variants have been described. The unprocessed precursor is 294 amino acids in length and has a predicted molecular weight of 33.6KDa. It belongs to the UPF0046 familly and is predominantly expressed in fetal brain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MPPED2 Antibody (NBP1-80499)(2)

Publications using NBP1-80499

• Pellecchia S, De Martino M, Esposito F et al. MPPED2 is downregulated in glioblastoma, and its restoration inhibits proliferation and increases the sensitivity to temozolomide of glioblastoma cells Cell cycle (Georgetown, Tex.) 2021-03-18 [PMID: 33734003]
• Pellecchia S, Sepe R, Federico A et al. The Metallophosphoesterase-Domain-Containing Protein 2 (MPPED2) Gene Acts as Tumor Suppressor in Breast Cancer Cancers (Basel) 2019-06-08 [PMID: 31181813] (WB, Human)

Bioinformatics

• Gene Symbol: MPPED2
• Uniprot:
  • NP_001575(Human)