Novus Biologicals products are now on bio-techne.com

MPPED2 Antibody

Images

 
Western Blot: MPPED2 Antibody [NBP1-80499] - MPPED2 reduces cell proliferation of breast carcinoma cell lines. qRT-PCR (left panel) performed in MDA-MB-231 and SKBR3 cells stably expressing MPPED2 or carrying the ...read more
Western Blot: MPPED2 Antibody [NBP1-80499] - A204 cell lysate, concentration 0.2-1 ug/ml.
MPPED2 reduces cell proliferation of breast carcinoma cell lines. (A,B) qRT-PCR (left panel) performed in MDA-MB-231 and SKBR3 cells stably expressing MPPED2 or carrying the corresponding empty vector (EV). Data are ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

MPPED2 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptide directed towards the C terminal of human MPPED2. Peptide sequence PKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MPPED2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Publications
Read Publications using
NBP1-80499 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for MPPED2 Antibody

  • 239FBchromosome 11 open reading frame 8
  • C11orf8dJ1024C24.1
  • D11S302E
  • dJ873F21.1
  • EC 3.1
  • FAM1B
  • Fetal brain protein 239
  • metallophosphoesterase domain containing 2
  • Metallophosphoesterase domain-containing protein 2
  • metallophosphoesterase MPPED2

Background

MPPED2 likely encodes a metallophosphoesterase. The encoded protein may play a role a brain development. Alternatively spliced transcript variants have been described. The unprocessed precursor is 294 amino acids in length and has a predicted molecular weight of 33.6KDa. It belongs to the UPF0046 familly and is predominantly expressed in fetal brain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38464
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF276
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IHC, KO, Simple Western, WB
NBP2-03390
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
H00008731-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
AF8150
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP3-05569
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-92038
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-40364
Species: Hu
Applications: IHC, IHC-P, IP, WB
608-A7
Species: Mu
Applications: Bind
NBP3-04738
Species: Hu, Mu
Applications: WB
NBP1-86440
Species: Hu
Applications: IHC, IHC-P, WB
NB100-2388
Species: Hu
Applications: WB
NB300-549
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-47708
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB100-87011
Species: Hu
Applications: IP, WB
NBP1-80499
Species: Hu
Applications: WB

Publications for MPPED2 Antibody (NBP1-80499)(2)

Reviews for MPPED2 Antibody (NBP1-80499) (0)

There are no reviews for MPPED2 Antibody (NBP1-80499). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MPPED2 Antibody (NBP1-80499) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MPPED2 Products

Research Areas for MPPED2 Antibody (NBP1-80499)

Find related products by research area.

Blogs on MPPED2

There are no specific blogs for MPPED2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MPPED2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MPPED2
Uniprot